KEGG   Caenorhabditis elegans (nematode): CELE_Y57A10A.31Help
Entry
CELE_Y57A10A.31   CDS       T00019                                 

Gene name
Y57A10A.31
Definition
(RefSeq) Uncharacterized protein
Organism
cel  Caenorhabditis elegans (nematode)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IBR zf-RING_2 zf-RING_5 zf-RING_UBOX zf-C3HC4 zf-C3HC4_2 zf-C3HC4_4 zf-C3HC4_5
Motif
Other DBs
NCBI-GeneID: 174872
NCBI-ProteinID: NP_496609
WormBase: WBGene00013270
Ensembl: WBGene00013270
UniProt: Q9NA71
Position
II:join(12289405..12289504,12290205..12290350,12291361..12291582,12291983..12292708,12293788..12294261,12295258..12295981,12296704..12296900,12297907..12298398,12299612..12300073)
Genome map
AA seq 1180 aa AA seqDB search
MAKGKKQRRSEKIIPLTQLAFVVDSRDPWDDEPPSKEDIARAHFENRQQKRDYLPVTTSR
ELRYAVEWPSVVKNVTVPYYQNESQDTSQALCGRSLVSTTVSTNPSCSTAQIDVAAFEQT
TRELVGRAANMKTRFWLKFCVVWPLGPQDIRRIHRENINFNKRRCEYLTFNNTPTAYLLI
DSDGDPEYTKNIIRRKLGSAAAPSPPILLAAPNSGYAIRFRHGEEMPTLIQKSSESQFAL
VFDEKYTEFTKCSARVFYERLLRCPLRFDRKLEQSEKLWIQKNLKRNDLAHRAIRVLEFY
SIEERNEIVGRADNSIKFLDALFCDTMQFYREAYEDLNLYIKYSNTPKHIECVSVTVRNE
SDKKHAESSFTSHGLSVLYFNRKMECDPAAKYDITLKTMVLQNFPRHLVTYESREWFVRR
IAKENFFQLQSVNSFVQWQSHAKRCCFKAKNRDFFKIINFAFYKIAHINRIYHPIDAPWI
EELQGGLGARSMMSVVLERPDVPWQIARERRGAIQEDELFTIYFKNVTVGMQLIEHVIRI
AGIEPIFRTDAADRDGPQLVPFYRRSFTVTRAARAVVTSKLRQLDAKLRATFCMLTKQED
PIMMQDDAQYYVVRIFEEWTPNSKSGVIGVHGWSQNAIQLFATQILEIMSPKEFSTENCP
EMTFGIGEQWVKSLQRKYHVLLDVDKYREVISVLGDDSEEVLKELETYSQKKSEILVASR
IPCFFPHLNDRVRCELLSPGIVEKIRRQLGAQKLYMDRESQCLDFQGSLEAYEKLIELLE
TLSNEVFKRETRNREAEEIPNLVCPICTAETGISNDFYRLECGHVMCRTCINTQIRSRID
EQQFNIRCEIDGCHRVLTPAEIMNIILGGSDRMKELDTQKLRRLTDRAKQLLIQTNEDLA
ACPSADCVGILSKSDDGLISEFKKCEACDRSYCRKCLAEPHPDDTCEEFARIRRPEDSIA
RYQKDMGSRVKKCPKCAVLVEKREGCNHMQCGCGTHYCWTCLYVAESSGDCYRHMQAEHG
GHGGEIDMNQLPDNEPGIQQAMLQQYRAPRAEDDPMFFDEHGFTDDDDSDADADDEAFVA
AIYPQQHANRDQFANYRRNAAAFEEPPAPPPPPPPPQYIRDLPQLLIDTFPTIYGDPETR
VDYVDFVNSAQTQDQLEANLVMLYQNAEEHLAVEPQRRGR
NT seq 3543 nt NT seq  +upstreamnt  +downstreamnt
atggctaaaggcaaaaaacagcgccgcagtgagaagatcataccattgacacaactcgcg
tttgtcgtcgattcaagagatccgtgggacgatgagccgccgtcaaaagaggacatcgct
cgtgcacattttgagaatcgccagcaaaaacgtgactatctgccggtcacaacatccaga
gagctccgttatgcagtagaatggccaagtgttgtgaagaatgttaccgtaccatattat
caaaatgagtcccaagacacaagccaggctctctgtggacgttccctcgtgtcaactacc
gtaagcaccaatccatcgtgctccaccgcacaaatcgacgtcgccgcgttcgagcaaacc
accagagagcttgtcggccgggccgctaacatgaaaactcgtttttggcttaaattttgt
gtcgtttggccactcggaccacaagatattcgacggattcacagagagaatatcaatttc
aacaagcgtcgctgcgaatacctcaccttcaacaacacgcctaccgcctacctactcatc
gactcggatggcgacccagaatacacaaagaacatcatccgccgaaagctgggctccgcc
gctgctccgtctccaccgattctactcgccgcgccgaacagtggctacgcgattcgattc
cgacacggtgaagaaatgccgacgctcattcaaaagtcatccgagtcgcagtttgcgctg
gttttcgacgaaaagtacacggaattcacgaaatgctcggctcgtgtgttctacgagaga
cttttgagatgtccgctacgtttcgatcgaaagttggagcaatcagagaagctttggata
cagaagaatctcaagagaaatgatttggctcaccgagcaattcgagttctcgaattctac
tcaattgaagaaagaaacgaaattgttggcagagcagataattccatcaaattcttggat
gctcttttttgtgatacaatgcaattttatcgggaagcctatgaggatttgaatctctat
attaaatactcgaatacaccgaaacacattgaatgtgtgtctgttacggtgcgaaatgag
tctgacaagaagcacgcggagagctcgttcacttctcatggactttcggttctttatttc
aatcgaaaaatggagtgtgatccggcagcgaaatatgatatcactttgaaaacaatggtt
ctccaaaacttcccacgtcacctggtaacatacgagtctcgagagtggtttgtgagacga
atcgccaaagaaaacttcttccaacttcaatcagtcaattcatttgtgcagtggcagtcg
cacgcgaaacgatgctgtttcaaggcgaaaaatcgagatttcttcaaaattatcaacttt
gcattctacaaaattgctcatatcaatcgaatctatcatcccatcgatgcaccatggatc
gaggagcttcaaggtggccttggagcccgttcgatgatgagtgtggtgctcgaacgacct
gatgttccatggcaaattgcacgtgagagacgaggagcgattcaggaggatgaacttttt
acgatttatttcaagaatgtcaccgttggaatgcaacttatagagcacgttattcgaatc
gctggaattgaaccgattttccgcactgatgccgctgatcgagatggaccccaactcgtc
ccattctaccgccgctcgttcaccgtaacccgtgccgcccgtgctgtcgtaacgtccaaa
cttcgtcaactcgacgcaaagctacgtgccacattctgtatgctcacgaaacaagaggat
ccgataatgatgcaagacgacgcccagtactacgtggttcgaatctttgaagaatggact
ccaaacagcaagtctggagtgatcggagttcatggatggagccaaaatgctatacaactg
ttcgcaacgcagattctggaaattatgagtccaaaggagttttccactgaaaattgtccc
gaaatgacgtttggaattggagaacaatgggtgaaaagtcttcagcgaaaatatcacgtg
cttttggatgttgataaatatcgtgaagttatcagtgtcctcggcgatgattctgaggag
gttctgaaagagttggagacgtattcccagaaaaaatctgaaattctcgtcgcatccagg
attccatgcttcttcccacatttgaatgatcgagttcgttgtgagctgctttcgccggga
attgttgagaagattcggagacagttgggcgctcagaagctttatatggaccgggaaagt
caatgtttggattttcaaggatcgttggaggcgtacgagaagcttatcgagctacttgag
acgttgagcaatgaggtttttaagcgagaaaccaggaatcgcgaggcggaagaaatcccg
aatctcgtctgcccaatttgcaccgcagaaaccggaatctccaatgatttctatcgtctc
gagtgtggtcacgtgatgtgtcgtacctgtattaacacacaaattcgttcgcgaatcgac
gagcaacaattcaatattcggtgtgaaattgatggttgtcatcgggttttgacgccagct
gagattatgaacatcattctcggcggctcggatcgaatgaaagagctcgacacccaaaaa
ctccgccgtcttaccgatcgtgccaagcagctgctcattcaaaccaatgaagatcttgcc
gcatgcccatcagcggattgtgtcggaattctctcgaaatccgacgatggactaatttcc
gagttcaaaaagtgtgaagcttgtgatcgaagctattgccgaaaatgtctcgccgagccc
catccggatgatacgtgtgaagagtttgctcgtatccgacgcccggaagactcgattgct
cgctatcagaaggacatgggatcccgcgttaagaagtgcccgaaatgtgcagttttggtt
gaaaaacgagagggatgtaatcatatgcagtgtggttgtggaacacattactgctggacg
tgtctctatgttgctgaaagctctggtgactgctatcgtcatatgcaggcagagcatggt
ggacatggaggtgaaattgatatgaaccaactgcccgacaacgagccaggcattcaacaa
gcgatgctccaacaatatcgtgctccacgagccgaagatgatccaatgttcttcgatgag
cacggctttaccgacgacgatgacagtgacgctgacgctgatgatgaagcattcgtcgct
gcaatctatccacaacaacacgcgaatcgcgatcaattcgccaattatcgtcggaatgct
gcggcgttcgaagagccgccggcacctccaccaccgccaccgccacctcaatacattcga
gacttgccacaattgttgatcgacacgtttccgacgatttacggcgatccggaaacccgt
gtggattacgtggattttgtaaatagcgcgcagacacaggatcagttggaggccaacttg
gtgatgctctatcagaatgcagaggagcacctggccgtcgagccgcagcgacgtggacgt
tga

DBGET integrated database retrieval system