KEGG   Caenorhabditis elegans (nematode): CELE_Y63D3A.4Help
Entry
CELE_Y63D3A.4     CDS       T00019                                 

Gene name
tdpt-1
Definition
(RefSeq) 5'-tyrosyl-DNA phosphodiesterase
  KO
K19619  tyrosyl-DNA phosphodiesterase 2 [EC:3.1.4.-]
Organism
cel  Caenorhabditis elegans (nematode)
Brite
KEGG Orthology (KO) [BR:cel00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cel03400]
    CELE_Y63D3A.4 (tdpt-1)
Enzymes [BR:cel01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.-  
     CELE_Y63D3A.4 (tdpt-1)
DNA repair and recombination proteins [BR:cel03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Other NHEJ factors
     CELE_Y63D3A.4 (tdpt-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Exo_endo_phos UBA_4 TAP_C
Motif
Other DBs
NCBI-GeneID: 173276
NCBI-ProteinID: NP_493461
WormBase: WBGene00013405
Ensembl: WBGene00013405
UniProt: Q9XWG3
Structure
PDB: 

Position
I:complement(join(14097703..14097832,14098018..14098301,14099492..14099723,14099857..14099951,14100624..14100844,14100894..14100968,14101032..14101083))
Genome map
AA seq 362 aa AA seqDB search
MSNSDDEIQEIEAKRQKMSQEDSEVEIEILDEPEQGKLKNSSMSDEQKLHEFAIITATDE
AFAQSILQDVDWDLKKALDVFYGSEAFAEARSAAVMGASSSMASSGAAVMTAEDLKGFEV
SVMSWNIDGLDGRSLLTRMKAVAHIVKNVNPDILFLQEVVDRDLAPIDKLQSLYKIYYSN
KGCQYYTAILVSKMFDVEKHDVIHFQNSGMYRTLQILEGSIGGLKVFLLNTHLESTREHR
PQRCAQFGFCMDKVREIIAQNPGALVFFGGDLNLRDEEVSRVPDGVKDAWEAAGSDNKTK
FTWDTFKNDNKQGFHGAKMRFDRLYWSGPLDKVKFTLEGRQRIRSCLCFPSDHWAINATF
FA
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaattctgacgatgaaatacaggaaattgaggctaaacgacagaaaatgtcccaa
gaagattccgaggtcgaaatcgagattctagatgagccggagcaaggaaaactgaaaaat
tcgtcgatgagcgacgagcaaaaactgcatgaatttgcaataatcacggccacagatgag
gcttttgcgcagtcgattttacaggatgtagactgggatttgaagaaggctctggacgtt
ttttacgggagtgaggcgttcgcagaggccagaagtgcggccgtaatgggcgcttcatcg
tctatggcgagctctggagctgcggtgatgacggcagaggatttgaagggattcgaagtc
agcgtaatgtcgtggaacattgatgggctcgacgggagaagcttgctcacaagaatgaaa
gcagtggctcatattgtcaaaaacgtcaatccggacatcctattcctccaagaagtcgtc
gaccgtgatttggcgccgattgataagcttcaatcgctgtataaaatctattattcgaac
aaaggctgccaatattatacggcgattcttgtgtcgaaaatgttcgacgtcgagaagcat
gacgtcattcattttcagaattctggaatgtacagaactttgcagattttggagggatct
attggcggtttgaaggtattcctacttaacacccatctcgaatcaacacgtgagcaccgc
ccgcaacgttgtgctcaattcggcttctgcatggacaaagtccgtgaaatcatcgctcaa
aacccgggcgccctcgtctttttcggcggcgatttgaacttacgagacgaggaggtcagc
cgtgtgcctgacggtgttaaggatgcctgggaggctgccggcagtgataataagacaaaa
ttcacgtgggacaccttcaaaaatgacaataaacagggattccatggcgctaagatgaga
ttcgaccgcctatactggtctggaccactggacaaagtcaaattcacacttgaaggccgc
caacgcatccgttcctgtttgtgcttcccatctgatcattgggctatcaatgccacgttt
tttgcctga

DBGET integrated database retrieval system