KEGG   Caenorhabditis elegans (nematode): CELE_Y65B4A.8Help
Entry
CELE_Y65B4A.8     CDS       T00019                                 

Gene name
Y65B4A.8
Definition
(RefSeq) Uncharacterized protein
  KO
K02318  phosphopantetheine adenylyltransferase / dephospho-CoA kinase [EC:2.7.7.3 2.7.1.24]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel00770  Pantothenate and CoA biosynthesis
cel01100  Metabolic pathways
Module
cel_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:cel00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    CELE_Y65B4A.8 (Y65B4A.8)
Enzymes [BR:cel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.24  dephospho-CoA kinase
     CELE_Y65B4A.8 (Y65B4A.8)
   2.7.7  Nucleotidyltransferases
    2.7.7.3  pantetheine-phosphate adenylyltransferase
     CELE_Y65B4A.8 (Y65B4A.8)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoaE CTP_transf_like Cytidylate_kin2 FAD_syn AAA_18 Zeta_toxin SKI Fasciclin Pantoate_ligase
Motif
Other DBs
NCBI-GeneID: 171657
NCBI-ProteinID: NP_490766
WormBase: WBGene00022031
Ensembl: WBGene00022031
UniProt: Q9BL56
Position
I:complement(join(660005..660276,661314..661920,662932..663014,663066..663382,663443..663549))
Genome map
AA seq 461 aa AA seqDB search
MSSKYGLLVLNSKNVQKLKQLLTSAAAALSSKLYVRLNPDEPRTDELVSKIYLTSASSCP
KLDVRLVVSEIRGNPENYVLIGEEKLLENAEKLAAAKKYKKVVLGGTFDRLHNGHKVLLN
KAAELASDVIVVGVTDKDMIIKKSLFEMIEPVEFRIKKVVDFVEDISGTAKCLAEPIIDP
FGPSTRIKDLEAIVVSRETIKGADAVNKKRNEQGMSQLDVIIVELVEGSDEILKETKISS
SSRRREDLGHLLRPARAVPRETGAPYIIGLAGGIASGKSHIGKYLRETHNFDVIDCDKLA
HTCYERGSSLNRKIGEHFGGDVVVDGVVDRRKLGTIVFSDKVKLRELSELVWPEVKEKAM
EIVKKSTAKVVVIEAAALIEAGWHKTLAETWTVFVPADEAVRRVVARDNLTEDQAKDRMS
SQISNKERLDNSNVALCSLWAYEETHAQVDRAVEELMKRIL
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgagctcgaaatacggacttctcgtgttaaatagcaaaaatgtgcaaaaactgaagcaa
ttgctcacgtctgcggccgccgcgttaagctcgaagctttatgtgagattaaacccggac
gagccgcgaaccgacgagctagtctcgaaaatctacctaacatcggcgagctcatgcccg
aagctcgacgtccgtctagttgtgtcggaaatccgcggaaatcccgagaattatgtgcta
atcggcgaggaaaagctgctggagaacgcggaaaaattggcggcggcgaaaaagtacaaa
aaagtcgtgttgggcggcacattcgatcggcttcacaatgggcacaaagtgttgctcaac
aaggctgccgagctcgcttctgatgttattgtcgtgggggtcaccgataaggatatgatt
attaaaaaatcattattcgagatgattgagcctgtggagtttcggattaagaaagttgtc
gattttgtagaggatatttccgggactgcaaaatgtctcgcggagccaataatcgaccca
ttcggtccttcaacacgaataaaagacctcgaagcgatagtagtgtcccgggagaccatt
aaaggtgccgatgcggtgaacaaaaagagaaatgagcaaggaatgtcgcagctggatgtg
ataattgtcgagctggtggaaggatccgatgagatcctgaaagagacaaagatcagctca
agctccagacgacgagaggatctgggtcacttgctccgtccagctcgggcggttccaaga
gaaacgggcgccccgtacatcattgggctcgccggaggaattgcgtcgggaaaaagtcat
atcgggaaatatctccgtgaaacgcataatttcgatgttatcgattgtgataagctcgca
cacacgtgctatgaacggggaagctcgttgaatcgaaaaatcggcgaacattttggaggg
gatgtcgttgtcgatggagttgtagaccgccggaagcttggaacgattgtgttttcggat
aaggtgaagctccgcgagctgagtgagcttgtttggccggaggtgaaagagaaagctatg
gagattgtgaagaagtcgacggcgaaagttgttgtcatcgaagcggccgcactaatcgaa
gccggatggcacaaaacgctcgccgaaacgtggaccgtcttcgtgccagcagatgaagcc
gtccgtcgagtcgttgcgagggataacctgactgaagatcaggccaaggatcgcatgtcg
tcacagatttcgaataaggaacgtctcgacaatagcaacgtggcgttgtgctctctgtgg
gcgtacgaggagactcatgcacaggtcgatcgagctgtggaagagttgatgaagagaatt
ttgtag

DBGET integrated database retrieval system