KEGG   Caenorhabditis elegans (nematode): CELE_Y66D12A.7
Entry
CELE_Y66D12A.7    CDS       T00019                                 

Gene name
Y66D12A.7
Definition
(RefSeq) Glutamyl-tRNA(Gln) amidotransferase subunit C, mitochondrial
  KO
K02435  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit C [EC:6.3.5.6 6.3.5.7]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel00970  Aminoacyl-tRNA biosynthesis
cel01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cel00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CELE_Y66D12A.7 (Y66D12A.7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:cel03029]
    CELE_Y66D12A.7 (Y66D12A.7)
Enzymes [BR:cel01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     CELE_Y66D12A.7 (Y66D12A.7)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     CELE_Y66D12A.7 (Y66D12A.7)
Mitochondrial biogenesis [BR:cel03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    CELE_Y66D12A.7 (Y66D12A.7)
SSDB
Motif
Pfam: Glu-tRNAGln
Other DBs
NCBI-GeneID: 176590
NCBI-ProteinID: NP_499495
WormBase: WBGene00013433
Ensembl: WBGene00013433
UniProt: Q9BI40
Position
III:complement(join(11579281..11579700,11580348..11580455))
AA seq 175 aa
MNLIFTRIIRRFGEGKRKTPFPGDPILVPDEPYDSKIQESQLSPMPQIDAKLINHLERLS
LVRFDSEQAVANLRSSIRVAKRLELVDVEGVEPMHTVWEDQECPTFEDVEEDPLPIEEVF
RNASLRFDDFFVTPPGNLPLESKERFDLNVINEWDTIGKPVAPEVKLTRMTERKK
NT seq 528 nt   +upstreamnt  +downstreamnt
atgaatctgatattcacacggataataagaagatttggagaaggaaaacgaaaaacgcca
tttccaggtgacccgattcttgttccagatgagccgtacgatagtaagatccaagaatcc
cagctatctccaatgccacaaatcgacgcaaagctgatcaaccatctcgagcggctctca
ctcgttcgattcgattcagagcaagctgttgcgaatctgcggagctcgattcgtgtcgcc
aagcgtctggagctcgtggatgtcgagggcgtcgagccgatgcacaccgtttgggaagat
caagagtgtccgacgtttgaggatgttgaagaggatccgttgccgattgaggaggttttt
cggaatgctagcctccgattcgacgatttctttgtgacaccaccgggaaatctgccgctc
gagtcgaaggaacgattcgatttgaatgtgattaatgagtgggatacgattgggaagcct
gttgctcctgaagtcaagctcacaaggatgacggaaaggaagaaataa

DBGET integrated database retrieval system