KEGG   Caenorhabditis elegans (nematode): CELE_Y67H2A.8Help
Entry
CELE_Y67H2A.8     CDS       T00019                                 

Gene name
fat-1
Definition
(RefSeq) Omega-3 fatty acid desaturase fat-1
  KO
K10257  acyl-lipid omega-3 desaturase [EC:1.14.19.25 1.14.19.35 1.14.19.36]
Organism
cel  Caenorhabditis elegans (nematode)
Brite
KEGG Orthology (KO) [BR:cel00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:cel01004]
    CELE_Y67H2A.8 (fat-1)
Enzymes [BR:cel01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.25  acyl-lipid omega-3 desaturase (cytochrome b5)
     CELE_Y67H2A.8 (fat-1)
    1.14.19.35  sn-2 acyl-lipid omega-3 desaturase (ferredoxin)
     CELE_Y67H2A.8 (fat-1)
    1.14.19.36  sn-1 acyl-lipid omega-3 desaturase (ferredoxin)
     CELE_Y67H2A.8 (fat-1)
Lipid biosynthesis proteins [BR:cel01004]
 Desaturase
  Omega
   CELE_Y67H2A.8 (fat-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FA_desaturase DUF3474
Motif
Other DBs
NCBI-GeneID: 178291
NCBI-ProteinID: NP_001023560
WormBase: WBGene00001393
Ensembl: WBGene00001393
UniProt: Q9NEQ0
Position
IV:join(13315646..13316137,13317092..13317463,13318262..13318606)
Genome map
AA seq 402 aa AA seqDB search
MVAHSSEGLSATAPVTGGDVLVDARASLEEKEAPRDVNANTKQATTEEPRIQLPTVDAFR
RAIPAHCFERDLVKSIRYLVQDFAALTILYFALPAFEYFGLFGYLVWNIFMGVFGFALFV
VGHDCLHGSFSDNQNLNDFIGHIAFSPLFSPYFPWQKSHKLHHAFTNHIDKDHGHVWIQD
KDWEAMPSWKRWFNPIPFSGWLKWFPVYTLFGFCDGSHFWPYSSLFVRNSERVQCVISGI
CCCVCAYIALTIAGSYSNWFWYYWVPLSFFGLMLVIVTYLQHVDDVAEVYEADEWSFVRG
QTQTIDRYYGLGLDTTMHHITDGHVAHHFFNKIPHYHLIEATEGVKKVLEPLSDTQYGYK
SQVNYDFFARFLWFNYKLDYLVHKTAGIMQFRTTLEEKAKAK
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggtcgctcattcctcagaagggttatccgccacggctccggtcaccggcggagatgtt
ctggttgatgctcgtgcatctcttgaagaaaaggaggctccacgtgatgtgaatgcaaac
actaaacaggccaccactgaagagccacgcatccaattaccaactgtggatgctttccgt
cgtgcaattccagcacactgtttcgaaagagatctcgttaaatcaatcagatatttggtg
caagactttgcggcactcacaattctctactttgctcttccagcttttgagtactttgga
ttgtttggttacttggtttggaacatttttatgggagtttttggattcgcgttgttcgtc
gttggacacgattgtcttcatggatcattctctgataatcagaatctcaatgatttcatt
ggacatatcgccttctcaccactcttctctccatacttcccatggcagaaaagtcacaag
cttcaccatgctttcaccaaccacattgacaaagatcatggacacgtgtggattcaggat
aaggattgggaagcaatgccatcatggaaaagatggttcaatccaattccattctctgga
tggcttaaatggttcccagtgtacactttattcggtttctgtgatggatctcacttctgg
ccatactcttcactttttgttcgtaactctgaacgtgttcaatgtgtaatctctggaatc
tgttgctgtgtgtgtgcatatattgctctaacaattgctggatcatattccaattggttc
tggtactattgggttccactttctttcttcggattgatgctcgtcattgttacctatttg
caacatgtcgatgatgtcgctgaggtgtacgaggctgatgaatggagcttcgtccgtgga
caaacccaaaccatcgatcgttactatggactcggattggacacaacgatgcaccatatc
acagacggacacgttgcccatcacttcttcaacaaaatcccacattaccatctcatcgaa
gcaaccgaaggtgtcaaaaaggtcttggagccgttgtccgacacccaatacgggtacaaa
tctcaagtgaactacgatttctttgcccgtttcctgtggttcaactacaagctcgactat
ctcgttcacaagaccgccggaatcatgcaattccgaacaactctcgaggagaaggcaaag
gccaagtaa

DBGET integrated database retrieval system