KEGG   Caenorhabditis elegans (nematode): CELE_Y69A2AR.30Help
Entry
CELE_Y69A2AR.30   CDS       T00019                                 

Gene name
mdf-2
Definition
(RefSeq) MAD (yeast Mitosis arrest DeFicient) related
  KO
K02537  mitotic spindle assembly checkpoint protein MAD2
Organism
cel  Caenorhabditis elegans (nematode)
Brite
KEGG Orthology (KO) [BR:cel00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cel03036]
    CELE_Y69A2AR.30 (mdf-2)
Chromosome and associated proteins [BR:cel03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Core SAC proteins
     CELE_Y69A2AR.30 (mdf-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HORMA bacHORMA_2 Imm35
Motif
Other DBs
NCBI-GeneID: 177046
NCBI-ProteinID: NP_001023563
WormBase: WBGene00003161
Ensembl: WBGene00003161
UniProt: Q9NGT3
Position
IV:complement(join(2636550..2636621,2637545..2637686,2639635..2639697,2640562..2640679,2640744..2640890,2640941..2641010))
Genome map
AA seq 203 aa AA seqDB search
MTDVKTQNAISLKGSAQLVKEFFHFGLNSILYQRALYPSDSFKREKKYGLTLWVAHEKKL
QAFMDPLLQQVEYWLAKRQLKRLVMVISEVKTKEVVERWQFDIHTENLAEEGENAHRVKE
EKKIRQEISDVIRQITASVSFLPLLEEPVSFDVLIYTGKDTQAPEDWTESGACLIQNSET
VQLRSFSTSVHSVNTNVQYKADF
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgacggatgtaaagacacaaaacgcgatttccctcaaaggatctgcccaactcgtcaaa
gagttcttccatttcggccttaacagcattctctatcaacgtgcgctttatccatcagac
agtttcaagcgtgagaagaagtacgggctcacactgtgggtggctcatgagaagaagctc
caagcgttcatggatccacttttgcagcaagttgaatattggctcgcgaaaagacagctg
aaacggttggtgatggtgatttccgaggtgaagacgaaggaagtcgtggaaagatggcaa
ttcgatattcatacagagaatttggccgaggaaggagaaaacgcgcaccgcgtcaaggag
gagaagaagattcggcaggagattagcgatgtgattcgccaaatcaccgcatctgtgtca
ttcttgccactgctcgaggagcctgtctcgttcgatgtgctcatttacactggaaaagat
actcaagcacccgaggactggactgaaagcggagcctgtttgattcagaattcggagact
gtgcaacttcgctcattctcgacgtcagttcactcggttaacacgaatgtacagtacaag
gcggatttttaa

DBGET integrated database retrieval system