KEGG   Caenorhabditis elegans (nematode): CELE_Y69E1A.7Help
Entry
CELE_Y69E1A.7     CDS       T00019                                 

Gene name
aqp-3
Definition
(RefSeq) AQuaPorin or aquaglyceroporin related
  KO
K09886  aquaglyceroporin related protein, invertebrate
Organism
cel  Caenorhabditis elegans (nematode)
Brite
KEGG Orthology (KO) [BR:cel00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cel02000]
    CELE_Y69E1A.7 (aqp-3)
Transporters [BR:cel02000]
 Other Transporters
  Aquaporins and small neutral solute transporters [TC:1.A.8]
   Aquaglyceroporins or glycerol-uptake facilitators
    CELE_Y69E1A.7 (aqp-3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MIP TfuA Phage_holin_5_2
Motif
Other DBs
NCBI-GeneID: 190553
NCBI-ProteinID: NP_001309613
WormBase: WBGene00000171
Ensembl: WBGene00000171
UniProt: A0A131MBS2
Position
IV:complement(join(10961355..10961406,10961454..10962000,10962075..10962339,10962387..10962488,10962960..10963105,10966403..10966415))
Genome map
AA seq 374 aa AA seqDB search
MIFQGSPPFAVDRKSVDNSVVAVTDTPFEFAPSQKSSQHTNRPPPFVKPEEEMMYINHVE
RLKPKFAIGNELIRAFLAELFCTGFLVFGGECVNAQYVLSQGKNNEWIGISVGWGLVLML
AVLMGSKISGAHLNPAVSFFQLTQGKINLIRFLVYAVAQNIGAFLGAFGVFCVYYDAINV
FEGGNRTVTGPTATASIFATYPGPFLGTFNAIVDQIAGTLVLCLGVAAITDRRNGIPAFL
QPAWIGALLAFLGMSLALNAGYAINPARDFAPRLFNLCAGYGWEVFSYRNYKWFWIPIIC
PMIGGVLGAWLYEFFIGFHIQDEDAVSLDSESDKQLKTMIDNMVDIENQLPEYTDKKQLS
DIASIHQNPSLRNI
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgatatttcagggatcgccgccctttgctgtagacagaaaatcagtggacaactcagtt
gtcgctgtaactgatacaccgttcgagtttgctccgagtcaaaagtcatcacagcatacg
aataggccaccgccgtttgtgaagcctgaagaggaaatgatgtacataaatcatgttgaa
cgcctcaagcccaaattcgccattggcaatgagctcatccgagcatttcttgcagaatta
ttctgcactggattcctagttttcggaggagaatgtgtcaatgcgcaatatgttctttca
caaggaaagaacaacgaatggattggaatttcagttggttggggacttgtattaatgctt
gctgtgctcatgggatccaagatatccggtgctcatttgaatcctgctgtatcattcttt
caactcactcaagggaaaatcaatttgatacgctttttagtgtatgcagtggcccagaat
attggagcatttcttggagcattcggagttttttgtgtatattatgatgccataaacgta
ttcgaaggaggaaatcgtacagtaaccggaccaacagcaactgcatctatttttgcaacc
tatcctggacccttcttaggaactttcaatgcaattgtggatcaaatcgccggaactcta
gtactttgtcttggagtagcagccatcacagatcgtcgaaacggaataccagccttcctc
caaccagcatggattggagcacttctcgcattcctcggaatgtcacttgctttaaatgct
ggttatgcaatcaatccagcacgtgattttgcacctcgtctcttcaatttatgtgcaggt
tacggatgggaagttttcagttatagaaattataaatggttctggattccaattatttgc
ccaatgattggtggcgttcttggtgcatggctttacgaatttttcattggtttccatatt
caagatgaagatgctgtctcattagattccgaaagtgataagcaattgaagactatgatt
gataatatggtagatattgagaatcaacttcccgaatatacagataagaaacaattatcc
gacatagcatcgattcatcaaaacccaagtttgcgaaacatttag

DBGET integrated database retrieval system