KEGG   Caenorhabditis elegans (nematode): CELE_Y69F12A.2Help
Entry
CELE_Y69F12A.2    CDS       T00019                                 

Gene name
alh-12
Definition
(RefSeq) ALdehyde deHydrogenase
  KO
K00149  aldehyde dehydrogenase family 9 member A1 [EC:1.2.1.47 1.2.1.3]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel00010  Glycolysis / Gluconeogenesis
cel00053  Ascorbate and aldarate metabolism
cel00071  Fatty acid degradation
cel00280  Valine, leucine and isoleucine degradation
cel00310  Lysine degradation
cel00330  Arginine and proline metabolism
cel00340  Histidine metabolism
cel00380  Tryptophan metabolism
cel00410  beta-Alanine metabolism
cel00561  Glycerolipid metabolism
cel00620  Pyruvate metabolism
cel01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cel00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CELE_Y69F12A.2 (alh-12)
   00053 Ascorbate and aldarate metabolism
    CELE_Y69F12A.2 (alh-12)
   00620 Pyruvate metabolism
    CELE_Y69F12A.2 (alh-12)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CELE_Y69F12A.2 (alh-12)
   00561 Glycerolipid metabolism
    CELE_Y69F12A.2 (alh-12)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CELE_Y69F12A.2 (alh-12)
   00310 Lysine degradation
    CELE_Y69F12A.2 (alh-12)
   00330 Arginine and proline metabolism
    CELE_Y69F12A.2 (alh-12)
   00340 Histidine metabolism
    CELE_Y69F12A.2 (alh-12)
   00380 Tryptophan metabolism
    CELE_Y69F12A.2 (alh-12)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CELE_Y69F12A.2 (alh-12)
Enzymes [BR:cel01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     CELE_Y69F12A.2 (alh-12)
    1.2.1.47  4-trimethylammoniobutyraldehyde dehydrogenase
     CELE_Y69F12A.2 (alh-12)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 176056
NCBI-ProteinID: NP_001022930
WormBase: WBGene00000118
Ensembl: WBGene00000118
UniProt: Q7Z1Q3
Position
III:join(7454089..7454197,7454386..7454531,7454586..7455619,7455693..7455903)
Genome map
AA seq 499 aa AA seqDB search
MVFTVPSDLSGGLYFLNGKRTTIESTETFDVIEPRIGQVVAKCPKATADIVDQYVKAAAD
AQSAWGETTALDRGKVLHKVADLIREHAEEIAIWEVKTNGKPIYEARCDIASSADTFDFF
GGIATAVLQGDSLELPGGPSQRIAYTRREPYGVVGCIGAWNYPFQTCVWKVAPALAAGNA
VVYKPSPFAPASPVLLGEILTAAGVPKGVYNVIQGEQEAGVALCEHNLVAKVSFTGSVAS
GEAVQRQAATKNVKPVTLELGGKSEIIIFDDSDVKSAVASAMLANFLNQGQVCTNATRVF
VQKGILASFTEAIVQEANDKLKVGDPLLEDTRVGANINEGHLQRILGYVESAKQEGGVVL
RGGVRVHPTGVEGGAYFEPAIITGLSDEARAVREEIFGAVMLILPFETEEEVIARANNTT
YGLAAGVFSGNLARGHRVAARLQAGTVFINTYNDTEVNVPFGGFKNSGHGRENCIDTLRA
HTQTKAIYVNVQDTTEHCF
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atggttttcaccgtcccttcggatctgtctggtggactttattttttgaatggaaagaga
acaacaattgagtcaactgagacatttgacgtaattgagccacgtatcggacaagtcgtt
gctaaatgcccaaaagcaacagcggatattgttgatcaatacgttaaagctgctgctgat
gctcaatcagcatggggagaaactactgctttggacagaggaaaggttcttcataaagtt
gctgatttgattagagaacatgctgaagagatcgcaatttgggaagtgaaaaccaatgga
aaaccaatttatgaggctcgttgtgacattgcatcttcagctgacacttttgatttcttt
ggtggaatcgctacggcagttctccaaggagattctcttgaacttccaggtggaccatct
caacgtattgcctatacacgccgtgaaccatatggagttgttggatgtattggagcatgg
aactatccattccagacatgcgtttggaaggttgctccagcgcttgctgctggaaacgca
gttgtctataagccatctccatttgctccagcttcaccagtacttctaggagagatcctt
acagctgctggtgtacctaaaggagtatacaatgttattcaaggagaacaagaagctggt
gttgctctttgcgagcataatttggttgcaaaagtttctttcactggatcagttgcctca
ggagaagcagttcagcgtcaagccgccacaaagaatgtcaagccagtgacattggaacta
ggaggaaaatctgagatcattatcttcgacgattcagatgtcaaatctgcagtagcttct
gcaatgcttgcaaacttcttgaatcagggacaagtctgcacaaatgccacaagagttttt
gtacagaaaggaattttggcttctttcactgaagccattgttcaagaagctaatgataaa
cttaaagttggagatccacttcttgaagacactcgtgttggagctaatatcaacgaaggg
catcttcagagaattcttggatacgttgaaagtgccaagcaagaaggtggagtcgttttg
agaggaggagttcgtgtgcatccaactggtgtcgagggtggagcatattttgagccagca
ataattactggactttccgatgaagctagagctgttagagaagaaatctttggagctgtt
atgctcattttaccatttgaaacagaagaggaagttattgcaagagcaaataatacaact
tatggattggctgctggagtattctcaggaaatcttgctcgtggacaccgtgtcgctgct
cgccttcaagctggaactgttttcattaatacttataatgacactgaagtaaatgttcca
tttggaggattcaagaattcaggacatggacgtgaaaattgtatcgatactcttcgtgct
catactcagacaaaggcaatctatgtgaatgttcaagatactactgagcattgtttctag

DBGET integrated database retrieval system