KEGG   Caenorhabditis elegans (nematode): CELE_Y71F9B.4
Entry
CELE_Y71F9B.4     CDS       T00019                                 

Gene name
snr-7
Definition
(RefSeq) Probable small nuclear ribonucleoprotein G
  KO
K11099  small nuclear ribonucleoprotein G
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:cel00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    CELE_Y71F9B.4 (snr-7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:cel03041]
    CELE_Y71F9B.4 (snr-7)
   03032 DNA replication proteins [BR:cel03032]
    CELE_Y71F9B.4 (snr-7)
Spliceosome [BR:cel03041]
 Complex A
  U1 snRNP components
   Sm proteins
    CELE_Y71F9B.4 (snr-7)
  U2 snRNP components
    CELE_Y71F9B.4 (snr-7)
 Complex B
  U1 snRNP components
    CELE_Y71F9B.4 (snr-7)
  U4/U6.U5 tri-snRNP components
    CELE_Y71F9B.4 (snr-7)
 Complex C
  U2 snRNP components
    CELE_Y71F9B.4 (snr-7)
DNA replication proteins [BR:cel03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Telomerase complex (fungi)
    Sm core complex
     CELE_Y71F9B.4 (snr-7)
SSDB
Motif
Pfam: LSM
Other DBs
NCBI-GeneID: 171834
NCBI-ProteinID: NP_491032
WormBase: WBGene00004920
Ensembl: WBGene00004920
UniProt: Q9N4G9
Position
I:join(2727018..2727146,2727200..2727304)
AA seq 77 aa
MSKTHPPELKKYMDKEMDLKLNGNRRVSGILRGFDPFMNMVIDEAVEYQKDGGSVNLGMT
VIRGNSVVIMEPKERIS
NT seq 234 nt   +upstreamnt  +downstreamnt
atgagtaagacacatccaccagagctcaaaaagtacatggacaaggagatggacttgaag
ctcaacggaaaccgtcgcgtctctggaatcctccgcggtttcgatccattcatgaacatg
gtcatcgacgaagctgtcgagtaccaaaaggacggaggatccgtcaacctcggcatgact
gtcattcgcggaaactccgtcgtcatcatggagcccaaggagagaatctcctag

DBGET integrated database retrieval system