KEGG   Caenorhabditis elegans (nematode): CELE_Y75B7AL.3
Entry
CELE_Y75B7AL.3    CDS       T00019                                 

Gene name
snt-3
Definition
(RefSeq) SyNapTotagmin
Organism
cel  Caenorhabditis elegans (nematode)
SSDB
Motif
Pfam: C2 DOCK-C2
Other DBs
NCBI-GeneID: 190698
NCBI-ProteinID: NP_503406
WormBase: WBGene00004923
Ensembl: WBGene00004923
UniProt: Q965S5
Position
V:complement(join(1358560..1358676,1359179..1359244,1360114..1360446,1360863..1360940,1360996..1361163,1361218..1361310))
AA seq 284 aa
MSVSKKKDEDKEKKFLGRLQYKLDYDFDKNSLTVVIIQAEELPAMDLGGTSDPYVKLFLL
PDKKKKLQTKVQRKSLNPVFNESFTFKIPFNEIGGQTLVLNVFDFDRFGKHDQIGQISIP
LGKVDLAATLERTDLIESPPENRLGEVCLALRYVPNKNKLSVVVMECKNLKKMDVLGLSD
PYVKIYLMMGTKRLEKKKTTIKMKTLNPYYNESFSFDVTSEKMQRVHLHVTVSDYDRVGS
NERIGQVIIGTCATGVALKQWNDMLATPRRSVAQWHTLVPFNDD
NT seq 855 nt   +upstreamnt  +downstreamnt
atgtcagtgtccaaaaagaaagacgaggacaaggagaaaaagttcctcggtcgtctacaa
tacaaacttgattatgattttgataaaaactcgctcacggtggtaattattcaagccgaa
gagttacctgccatggatctgggtggtacctcggatccctacgtgaaactttttctgctt
cccgacaaaaagaagaagcttcagacaaaagtacagagaaagtcgttgaatccggttttt
aacgagagtttcacatttaaaattccgttcaatgaaattggaggtcaaactttggttctt
aatgtgttcgattttgatcgatttggaaaacatgaccagattggccaaatttcaattccc
ttgggaaaagtggatctagccgcaacactcgaacgaaccgatttaatagaatccccgcca
gaaaatcggcttggagaagtttgtctcgcccttagatacgtgccaaacaagaacaagctg
tctgtggtagtaatggagtgcaaaaatctgaaaaaaatggacgtgcttggcttatcagat
ccgtatgtcaagatatatttgatgatgggcactaaacgactggagaagaaaaagacgaca
atcaagatgaagacgttgaatccgtattataacgaatcattcagttttgatgttacttcg
gaaaaaatgcagcgagtccaccttcatgtgacggtatccgattacgatagagttggttcc
aatgaacgaattggacaggtaattattggaacatgtgccacgggcgtggctttaaaacaa
tggaatgacatgttagcaaccccaagacgatcagttgctcaatggcatactctagttcct
ttcaatgatgattag

DBGET integrated database retrieval system