KEGG   Caenorhabditis elegans (nematode): CELE_Y87G2A.3
Entry
CELE_Y87G2A.3     CDS       T00019                                 

Gene name
atg-4.1
Definition
(RefSeq) Cysteine protease atg-4.1
  KO
K08342  cysteine protease ATG4 [EC:3.4.22.-]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04136  Autophagy - other
cel04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:cel00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    CELE_Y87G2A.3 (atg-4.1)
   04136 Autophagy - other
    CELE_Y87G2A.3 (atg-4.1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:cel01002]
    CELE_Y87G2A.3 (atg-4.1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cel04131]
    CELE_Y87G2A.3 (atg-4.1)
   03029 Mitochondrial biogenesis [BR:cel03029]
    CELE_Y87G2A.3 (atg-4.1)
Enzymes [BR:cel01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.-  
     CELE_Y87G2A.3 (atg-4.1)
Peptidases and inhibitors [BR:cel01002]
 Cysteine peptidases
  Family C54: Aut2 peptidase family
   CELE_Y87G2A.3 (atg-4.1)
Membrane trafficking [BR:cel04131]
 Autophagy
  Autophagosome formation proteins
   Atg8 conjugation proteins
    CELE_Y87G2A.3 (atg-4.1)
Mitochondrial biogenesis [BR:cel03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    CELE_Y87G2A.3 (atg-4.1)
SSDB
Motif
Pfam: Peptidase_C54 Peptidase_C78
Other DBs
NCBI-GeneID: 190777
NCBI-ProteinID: NP_001368160
WormBase: WBGene00013595
Position
I:complement(join(13537135..13537253,13537970..13538596,13540329..13540532,13541195..13541336,13541389..13541444,13542047..13542118,13542170..13542395))
AA seq 481 aa
MLSILPLAYSNFSRILQYFEQLPVVDKMTEEILKQGVGIVETSLTFEPPFCESFERISID
NFPIFALGKEISKEDGIEAMKKYVTSRFWFTYRRDFSPIGGTGPSTDQGWGCMLRCAQML
LGEVLLRRHIGRHFEWDIEKTSEIYEKILQMFFDEKDALYSIHQIAQMGVTEGKEVSKWF
GPNTAAQVMKKLTIFDDWSNIAVHVALDNILVKEDAITMATSYPSEDAVKLIMENGLVDK
NRLSLSPGNIIPEWRPLLLMIPLRLGLTTINPCYLSAIQEFFKIPQCVGIIGGRPNHALY
FVGMSGSKLFYLDPHYCRPKTESTAKMYAEKDSTATTDDVGFSHLEELVPLPSQTADVYT
KMDDSTYHCQMMLWIEYENVDPSLALAMFCETRDEFENLCETLQKTTLPASQPPMFEFLQ
RRPKYLPKFEPYTGVSMKIEMKEFDDIGAANVKIDDDFEVLDVHTEEEDADEDNDDDVAN
A
NT seq 1446 nt   +upstreamnt  +downstreamnt
atgttatcgattttaccgttggcgtacagcaatttcagccgaattttgcaatatttcgag
cagcttcccgtcgtcgacaaaatgaccgaagaaattctgaaacaaggcgtcggaattgtg
gaaacctcattgacatttgagccgcctttttgtgaatcttttgagcgaatttctatcgat
aatttcccgatttttgcgctcggaaaggagatttcaaaggaagatggaatcgaggcaatg
aaaaagtacgtcacatcgagattttggttcacttatcgcagagatttctccccaattggt
ggcacaggccctagcacggatcaaggatggggttgcatgctgagatgcgcacagatgctt
ctcggagaagtactccttcgccgtcacattggacgccattttgaatgggatattgagaag
acttcagagatttatgaaaagattttacaaatgtttttcgacgaaaaagacgcgctttac
tcgattcatcaaattgctcaaatgggtgttactgaaggaaaagaagtctcaaaatggttt
ggaccaaatacggcggctcaagtaatgaagaagctcacaattttcgatgattggtcgaat
atcgccgtccacgtggcacttgataatattcttgtgaaagaggatgctattacaatggca
acatcatatccaagtgaagatgctgttaaacttattatggaaaacggcctcgtcgacaaa
aaccgtctctccctctccccaggcaatataatccccgaatggcgtccccttctcctaatg
attcccctacgtttgggtctcaccacgatcaatccatgctatttatcagcaattcaagaa
ttctttaaaatcccacaatgcgtcggaattatcggtggtcgaccaaatcatgctctatac
tttgttggaatgtctggttcgaaacttttctatctggatcctcactattgccggccaaaa
actgaatcgacggccaaaatgtatgcagaaaaagattccacggccaccaccgatgacgta
ggcttcagtcatttggaagaacttgttccattaccatctcaaaccgcagacgtttacacg
aaaatggatgattccacgtatcattgtcaaatgatgttatggattgagtatgagaatgtg
gatccttcactcgcgttggcaatgttttgtgagacacgtgacgagtttgaaaatctgtgc
gagacccttcaaaaaaccacattgcctgcctcccaaccgcccatgttcgagtttttgcag
cggcggcccaagtatttgccaaaattcgaaccatacactggcgtttcgatgaagattgag
atgaaggaattcgatgacatcggcgccgccaacgtgaaaatcgatgatgattttgaagtt
ttggatgttcatacagaagaagaagacgcagacgaagacaatgatgatgacgtggcaaat
gcctaa

DBGET integrated database retrieval system