KEGG   Caenorhabditis elegans (nematode): CELE_Y87G2A.5
Entry
CELE_Y87G2A.5     CDS       T00019                                 
Symbol
glp-4
Name
(RefSeq) Valine--tRNA ligase
  KO
K01873  valyl-tRNA synthetase [EC:6.1.1.9]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:cel00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CELE_Y87G2A.5 (glp-4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cel01007]
    CELE_Y87G2A.5 (glp-4)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cel03016]
    CELE_Y87G2A.5 (glp-4)
Enzymes [BR:cel01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.9  valine---tRNA ligase
     CELE_Y87G2A.5 (glp-4)
Amino acid related enzymes [BR:cel01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   CELE_Y87G2A.5 (glp-4)
Transfer RNA biogenesis [BR:cel03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    CELE_Y87G2A.5 (glp-4)
 Prokaryotic type
    CELE_Y87G2A.5 (glp-4)
SSDB
Motif
Pfam: tRNA-synt_1 Anticodon_1 tRNA-synt_1g tRNA-synt_1_2 tRNA-synt_1e tRNA-synt_1b
Other DBs
NCBI-GeneID: 173224
NCBI-ProteinID: NP_493377
WormBase: WBGene00006936
Ensembl: WBGene00006936
UniProt: Q9U1Q4
Position
I:complement(13548074..13559361)
AA seq 1050 aa
MSDPAGNRPKTEKELKKEAEKAAKLAKFEEKQKKLAEKKAAASDKPVKEAKAKKEQTVEA
AEPVDQTPTGQRKKIDGEIPAAYFPGYVESGWYSWWEKEGFFKPEYIDKLNPGSNPADSF
TVCIPPPNVTGNLHVGHALATTVEDTITRFNRMHGKRTLFNPGCDHAGIATQVVVEKRLK
RERGLTRHDLGRDRFNQEVWHWKNEKGDVIYDQFRKLGASVDWDRAVFTMDPKMCRAVTE
AFIRMHESGTIYRSNRLVNWSCALRSAISDIEVDKKELTGSTLIAVPGYDKKIEFGVLNS
FAYKIQGSDEEIVVSTTRIETMLGDSGVAVHPDDQRYKHLVGKQCIHPFIPTRNLPIFAD
SFVEMEFGTGAVKITPAHDHNDYEVGIRQNLPFHNCITDDGLISQGCGEFSGMKRFDART
AVIEALKEKGLYRGKEDNPMVVPTCSRSKDVIEPILKPQWYVKCAHMAEKAVAAVANGDL
QIIPEFHKATWNRWLESSRDWCISRQLWWGHRIPAYYISFADGREQPLPEENYWVSARTE
QEALAKAAQKFQVPEAEILLKWDEDVLDTWFSSGMWPFAVFGWPDATKDMDLFFPGAVLE
TGHDILFFWVARMVFMAQELTGKLPFKEILLHAMIRDAHGRKMSKSLGNVIDPLDVIRGI
SLNDLQAQLLGGNLDEKEIAVAKEGQARDYPDGIPECGVDALRFALLSYTSQGRDINLDV
LRVHGYRKFCNKLWQVVRFALARISDKPEQKPTFEINLKSATPTDLWILSRLAKAVKETN
EALKAYNFTQATTVTYNFWLYDFCDVYVETIKPVLYGDNTTLRQVAISVLHKCIDTGLRL
ISPLMPFISEELWQRMPRLDDSDYTSPSIIVAQYPLTQKYEKYQNEKLEAAFEFAQELIG
KVRSLRADYDLKKTKITMQILSETPEDESMLNDISAVITTLTFSEKVSILNKCESDKIEK
GSAHIACGGRCQVYINLTGIIDVPKEIEKLGAKLQKNQISVKKIGDIQSSADYEQKVPVD
IRALDQEKKATLEKEIENITAAIAQLKALN
NT seq 3153 nt   +upstreamnt  +downstreamnt
atgtcggaccccgcaggaaaccgtccgaagacggaaaaagagctgaaaaaagaggcggag
aaggcggcgaaactcgcgaaattcgaggaaaagcagaaaaagcttgccgagaagaaggct
gccgcaagtgataagccggtgaaggaggccaaggccaaaaaggagcaaactgtggaagcg
gcggagcctgtagatcagactccaactggtcagaggaagaaaatcgacggagaaatcccc
gcggcctacttcccaggatacgtcgaatccggctggtactcttggtgggaaaaggaggga
ttcttcaagcccgagtacattgacaagctgaatccaggctcgaatcccgccgactcgttc
acagtttgcattccaccaccaaatgtgacaggaaatctacacgttggacacgcgctggcc
actaccgtcgaggatactatcaccagattcaacagaatgcacggaaaacggacacttttt
aatccgggatgtgatcatgctggaatcgcaacgcaagtcgtcgtcgagaaacgtctgaaa
cgagaacgtggattgacacgtcacgatttgggacgggatcgattcaatcaagaagtttgg
cactggaagaatgagaaaggggatgtgatttatgatcaattccgaaaactcggcgcctct
gtcgactgggatcgtgccgtttttacgatggatccgaaaatgtgccgggctgtaacggag
gcttttattcgaatgcacgagtctggaactatttacagatctaatagacttgtcaattgg
agttgcgcgctgagatctgcgatttctgacatcgaagtggacaagaaagagctaaccgga
agcacactgatcgccgtgcccggatacgataaaaaaatcgaattcggcgtgctcaactcg
ttcgcctacaagattcaaggatccgacgaggagattgtcgtctccacaacacgtatcgaa
acaatgctcggagattcaggagttgctgttcatccagacgatcagagatacaagcatctc
gtcggaaaacagtgtattcatccattcatccccacccgaaacctcccgatctttgccgac
tcattcgtcgagatggaattcggaaccggagcggtaaagatcactccagcacacgatcat
aatgattatgaagtcggaattcgtcaaaaccttccattccacaattgtatcacagatgat
ggtctgatctctcagggatgcggggaattctccggaatgaagagattcgacgccaggacc
gccgttattgaggctctcaaggagaagggtctctaccgtggaaaagaggataatccgatg
gttgtgccgacgtgttctagatccaaagatgtcattgagcctattctcaagcctcaatgg
tatgtcaagtgtgctcatatggcagagaaagccgtcgccgctgtcgccaacggtgatcta
caaatcattccggaattccataaagccacgtggaatcggtggttggagtcgagcagagat
tggtgtatctctaggcagctatggtggggacaccggatccctgcatactatatctcattt
gccgacggaagagaacaacctctgccagaggagaattattgggtctcggcacgaactgaa
caggaggcacttgccaaggcggcacagaaattccaagttcctgaagcggagatcctgctg
aaatgggatgaggatgtgcttgacacgtggttttcgtctggaatgtggccgtttgcagtt
tttggatggcctgatgccacaaaggatatggatttattcttccctggtgctgtgttggag
actggacatgatattctcttcttttgggttgcaagaatggtttttatggctcaggagttg
actggaaaacttccgtttaaagagatcctgctacacgcaatgatccgagatgcccatgga
cgtaaaatgtcaaaatccctcggaaatgtgattgatccactcgatgtgattcgtggaatc
tctctaaacgatcttcaagctcaacttctcggcggaaatctcgacgaaaaagagattgca
gttgcaaaagaaggacaagcacgtgattatccagatggaattcctgaatgtggtgtagat
gctcttcgatttgcactactttcctatacatcacaaggaagagatattaatttagatgtt
ctcagagttcatggatatcgaaaattctgtaataagctctggcaagttgtgagattcgcg
ttggcacgaatttctgataaaccggaacaaaaaccaacgttcgagattaatctgaaatca
gctacacctactgatctatggattctatcaagactcgcaaaagctgtcaaagagacgaat
gaggcattgaaggcatataacttcactcaggcaaccactgttacctacaatttctggtta
tacgacttctgtgatgtttatgtcgaaactatcaagcctgtgctttatggagacaacacg
actctccgccaggtggcaatttccgtccttcacaaatgtattgatacaggacttcgtctt
atttctccattaatgccattcatctcagaagaattatggcaacgtatgccacgtctcgac
gattcggattacacgtcaccatcgattattgttgcacaatatccattaacacagaaatat
gaaaaatatcaaaatgagaagctggaggctgcattcgaatttgcacaggagctcattgga
aaagtccgatcgttgagagctgattatgatttgaagaagactaagattactatgcaaatt
ctctccgaaacaccagaagacgagtcaatgctcaatgatatatctgcagtgataaccacc
ttaacattcagtgaaaaagtctcaattctcaataaatgtgaatccgataaaattgaaaaa
ggttctgcacatattgcttgtggaggacgttgtcaagtatacatcaatttgactggaatt
atcgatgttccaaaagaaatcgaaaagctcggagccaaattgcaaaagaatcagatttct
gtgaaaaagattggagatattcaatcgagtgctgattatgagcaaaaagttccagttgat
attcgtgctctggatcaggaaaagaaagcaaccctggagaaggaaatcgaaaacatcact
gcggcgattgcacaactcaaggctctcaactaa

DBGET integrated database retrieval system