KEGG   Caenorhabditis elegans (nematode): CELE_Y94H6A.1Help
Entry
CELE_Y94H6A.1     CDS       T00019                                 

Gene name
nhr-277
Definition
(RefSeq) Nuclear Hormone Receptor family
Organism
cel  Caenorhabditis elegans (nematode)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: zf-C4 Hormone_recep
Motif
Other DBs
NCBI-GeneID: 190799
NCBI-ProteinID: NP_500250
WormBase: WBGene00022374
Ensembl: WBGene00022374
UniProt: Q9N2W3
Position
IV:join(2743007..2743186,2743566..2743800,2744180..2744280,2745332..2745435,2745484..2745601,2745938..2746072,2746122..2746273,2746329..2746450,2746510..2746667,2747186..2747377)
Genome map
AA seq 498 aa AA seqDB search
MLTNMLLHADHHFYSSSQFASYYQYSQSSQFFEQMLRESSEIRAPSSGESRIPVVGRLKM
PPPPPKLKHCEVCGNAGATSHYGGTVCGGCKIFFSRTVQSRKGFVCERGGQCPMNAGKRA
KCRACRFQLCLKARMSPEEVGRLRDMRMGDYLPIVKKEGCVVGYFDESSQPSTSIEDCTS
QVHSFIDTFKYKEDEMSVVNIFVNLERSCENNAALCYRDDFPKTFNASIDLQSAMEFPLP
ICERIPMDFLRKLFLRDPKENFKLFWCRSVLHFLQWCSAIEDLNYFSRQERTMLIAENFV
SIGCLINFYGFLKIQREEFENCPEDGQIPAPCSAEWFQELSGLSFEAQTAVHRAISEIME
PMDSLDVSIEELVLMKFIMMFSEPSTQTSGDIYRIRSYRLKYCELLQKYIKTQIPDPERR
IARIGELLKIVEAVKTTSQYFDKWMTMFFASNTCQMNDVLVYDFHVRMWSDVIPTSTSSS
SSSIFATSSTLQKIKKEY
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgttgaccaacatgctacttcacgccgatcaccacttttattcgtcgtcgcaattcgcg
agctactaccagtactcgcaaagttcacagttcttcgagcaaatgcttcgtgagagctcc
gagatacgggctccgagcagtggcgagtcgaggataccggttgtcggacgtttaaagatg
ccccctcctccaccgaaactcaagcattgcgaggtgtgtggcaacgctggtgccacgtca
cactacggtggtacggtatgtggtggatgcaagattttcttctcacggacagtgcaaagc
agaaaaggattcgtctgcgagcggggcggtcagtgcccgatgaacgctgggaagagggca
aagtgccgggcgtgcaggtttcagctgtgtttgaaggctcgtatgagtccggaagaagtc
ggacgtctccgagacatgcggatgggtgattatctgccgattgtgaagaaggaaggatgt
gtggtgggatatttcgacgagagctctcagccatcgacgtccatagaagactgcaccagc
caagtgcactccttcattgataccttcaaatacaaagaggatgagatgtcagttgtgaat
atttttgtaaacttggaacgatcttgcgaaaacaatgcagcattatgctaccgggacgat
ttccccaaaacgttcaatgcatcgattgatttgcaaagcgctatggagtttcctttgcca
atttgtgagcggatacctatggatttcctccgaaaactgttccttcgagacccgaaagaa
aatttcaagttgttctggtgcaggagtgtgctacattttcttcagtggtgctccgctata
gaagatttgaattatttctcacggcaggagaggacaatgctaatcgctgaaaattttgtt
tccatcggctgcctgatcaatttctacggatttttaaaaattcaaagagaagagtttgaa
aattgtccagaagacggccaaatcccggctccgtgctccgcagaatggtttcaagaactt
tcaggactgtcatttgaagctcaaactgccgtgcatcgcgcaatttccgagattatggag
cccatggactcgttggacgtcagtatagaggagcttgtgctcatgaagttcataatgatg
ttcagtgaaccttcaacccaaacgtccggtgacatctaccgtattcgcagttatcgatta
aagtactgcgagctgctccaaaaatatataaagactcagatacccgacccggaaaggcgg
attgctcgaatcggcgagctgctgaagattgtggaagctgtgaagaccacctcgcaatat
tttgacaaatggatgacaatgtttttcgcatcgaacacgtgtcaaatgaatgacgtattg
gtctacgatttccacgtcagaatgtggagtgacgtcatcccaacctccacgtcatcatca
tcatcatcgatatttgccacgtcatcaaccttgcaaaaaattaaaaaggaatattga

DBGET integrated database retrieval system