KEGG   Caenorhabditis elegans (nematode): CELE_ZC434.2Help
Entry
CELE_ZC434.2      CDS       T00019                                 

Gene name
rps-7
Definition
(RefSeq) 40S ribosomal protein S7
  KO
K02993  small subunit ribosomal protein S7e
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel03010  Ribosome
Module
cel_M00177  Ribosome, eukaryotes
Brite
KEGG Orthology (KO) [BR:cel00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    CELE_ZC434.2 (rps-7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:cel03011]
    CELE_ZC434.2 (rps-7)
Ribosome [BR:cel03011]
 Ribosomal Proteins
  Eukaryotes
   Small subunit
    CELE_ZC434.2 (rps-7)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_S7e GAPES4
Motif
Other DBs
NCBI-GeneID: 172901
NCBI-ProteinID: NP_492708
WormBase: WBGene00004476
Ensembl: WBGene00004476
UniProt: Q23312
Position
I:join(10330889..10331035,10331111..10331251,10331300..10331476,10331579..10331698)
Genome map
AA seq 194 aa AA seqDB search
MPEIIGKLLKSDGKVVSEIEKQVSQALIDLETNDDVQSQLKELYIVGVKEVELGNKSAII
IYVPVPQLKAFHKIHPALVRELEKKFGGRDILILAKRRILPKPQRGSKARPQKQKRPRSR
TLTAVHDAWLDELVYPAEVVGRRIRVKLDGKKVYKVHLDKSHQTNVGHKIGVFASVYRKL
TGKDVTFEFPDPIF
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgcccgagatcatcggcaagcttttgaagtccgacggaaaggtcgtctctgagatcgag
aagcaagtctcacaagctctcattgacttggagaccaacgatgatgtccagagccaattg
aaggaactgtacatcgtcggagtcaaggaggttgagcttggaaacaagtccgccatcatc
atctacgttccagtcccacaactcaaggctttccacaagatccacccagcccttgttcgt
gagttggagaagaagtttggaggaagagacatccttatcctcgccaagagacgtatcctt
ccaaagccacaaagaggaagcaaagccagaccacaaaagcaaaagagaccacgttcccgt
actcttaccgctgtccatgatgcttggcttgatgagctcgtctacccagctgaggtcgtc
ggaagacgtattcgtgtgaagttggacggaaagaaggtttacaaggttcacctcgacaag
tcccaccagaccaacgtcggacacaagattggagtcttcgcttcggtttaccgcaagctc
accggaaaggatgtcaccttcgagttcccagacccaattttctaa

DBGET integrated database retrieval system