KEGG   Caenorhabditis elegans (nematode): CELE_ZC434.5
Entry
CELE_ZC434.5      CDS       T00019                                 

Symbol
ears-1
Name
(RefSeq) glutamyl(E) Amino-acyl tRNA Synthetase
  KO
K01885  glutamyl-tRNA synthetase [EC:6.1.1.17]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel00860  Porphyrin metabolism
cel00970  Aminoacyl-tRNA biosynthesis
cel01100  Metabolic pathways
cel01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:cel00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin metabolism
    CELE_ZC434.5 (ears-1)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CELE_ZC434.5 (ears-1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cel01007]
    CELE_ZC434.5 (ears-1)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cel03016]
    CELE_ZC434.5 (ears-1)
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:cel02048]
    CELE_ZC434.5 (ears-1)
Enzymes [BR:cel01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.17  glutamate---tRNA ligase
     CELE_ZC434.5 (ears-1)
Amino acid related enzymes [BR:cel01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   CELE_ZC434.5 (ears-1)
Transfer RNA biogenesis [BR:cel03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    CELE_ZC434.5 (ears-1)
 Prokaryotic type
   Other AARSs
    CELE_ZC434.5 (ears-1)
Prokaryotic defense system [BR:cel02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    CELE_ZC434.5 (ears-1)
SSDB
Motif
Pfam: tRNA-synt_1c WHEP-TRS tRNA-synt_1c_C tRNA-synt_1e
Other DBs
NCBI-GeneID: 172904
NCBI-ProteinID: NP_001366832
WormBase: WBGene00001337
Ensembl: WBGene00001337
Position
I:join(10336413..10336552,10336614..10337978,10338546..10338639,10338843..10339190,10339258..10340640,10340692..10340811)
AA seq 1149 aa
MMITRELVLKANREQPPYASILALAASGFSLEKSVQFSEKQQLALNLDGELLSNDVEIAR
IIAQSTDAADSLLGSSIIDFAVVDDLTNFIADAVTKNDYSLLLGKDFPTKILDNSLTVAD
FAIFSVAHNNPQLKAKFSGIIDKVLKEPTLAAAHNFVGLYKSAAAPTATASTGKEKKKDE
GKFVELPGAEKGKVVVRFPPEASGYLHIGHAKAALLNQYYQQAFEGQLIMRFDDTNPAKE
NAHFEHVIKEDLSMLNIVPDRWTHSSDHFEMLLTMCEKLLKEGKAFVDDTDTETMRNERE
QRQDSRNRSNTPEKNLQLWEEMKKGSPKGLTCCVRMKIDMKSNNGAMRDPTIYRCKPEEH
VRTGLKYKVYPTYDFTCPIVDSVEGVTHALRTTEYHDRDDQYYFICDALGLRRPHIWEYA
RLNMTNTVMSKRKLTWFVDEGHVEGWDDPRLPTVRGVMRRGLTVEGLKQFIVAQGGSRSV
VMMEWDKIWAFNKKVIDPVAPRYTALDSTSPLVSIELTDSISDDTSNVSLHPKNAEIGSK
DVHKGKKLLLEQVDAAALKEGEIVTFVNWGNIKIGKIEKKGAVITKISATLQLDNTDYKK
TTKVTWLGDVKAEAGKTIPVVTADYDHIISKAIIGKDEDWKQFINFDSVHYTKMVGEPAI
KNVKKGDIIQIQRKGFYIVDQPYNPKSELSGVETPLLLIAIPDGHTGKEAEKPPKGAPVS
AAASSGGSDALQLYNSIEQQGGIVRDLKTKDAKSQATKDAIAKLLDLKKKYKELTGSDHK
PGAPPSAPAPTTPSSSESNSALNIYNLIEAQGLLVRELKGKDAKSQATKDAIAKLLELKK
QYKEVSGSDHKPGVPPAASVASAPAPAPAAGSTNALDIYHQIESQGALVRELKGKDAKSQ
ATKDAIAKLLALKKQYKEVTGSDHKPGVVPVSAPAPTPLAGGADIAGQIEAQGVLVRDLK
NKDSKSQETKDAIAKLLELKKNYKEVTGSDYKPGPAPAAAPAKVTVPAPSVSGGDTLSKQ
IDDQALLVRELKMKDAKSQETKDAIAKLLQLKKQYKDATGSDYKPAPAQLAASAAAAPAP
APAFDEAALLKEIEEQGAVVRDAKSKDPKSQDSADAINKLLALKANFKKATGKDFPAPSN
AQSKKGKKK
NT seq 3450 nt   +upstreamnt  +downstreamnt
atgatgatcaccagagagttggtgctgaaagcgaaccgagagcaaccgccgtatgcgtcg
attttggctcttgccgcgtctggattttccctcgagaagtctgttcaattctctgaaaag
cagcagcttgctcttaacttagacggagaactcctgtccaatgacgttgaaattgctaga
atcatcgctcaaagcactgatgctgctgatagtcttctaggatcttctatcatcgatttc
gctgtcgttgacgatcttacaaacttcattgctgatgctgtcacgaagaatgactattcc
ctccttttgggaaaggattttccgaccaaaattctcgataattccttgactgttgctgat
tttgccatcttctctgtggcgcacaacaatcctcaattgaaggccaagttctctggaatt
atcgacaaagttctcaaagaaccaaccctggctgctgctcacaactttgtcggattatac
aaaagtgcagctgctccaactgcaacggcatctactggaaaagaaaagaagaaggacgaa
ggaaagttcgttgagcttccaggagccgagaaaggaaaggttgttgtccgattcccacca
gaggcaagtggatatttgcatattggacacgctaaggcagcacttctcaatcaatactat
caacaagctttcgaagggcaactcatcatgcgattcgatgacacaaatccagccaaagag
aatgctcatttcgaacatgttatcaaagaggacctctcaatgctcaacatcgttcctgat
cgttggactcactcttctgatcattttgaaatgcttcttaccatgtgtgagaaattgttg
aaggaaggaaaggcattcgtcgatgatactgacactgaaactatgcgtaatgaacgagaa
cagagacaagacagtcgtaatcgttcaaacactccagaaaagaatctccaattgtgggaa
gaaatgaaaaaaggttctccaaaaggattaacttgctgtgttcgtatgaagatcgacatg
aaatcaaataatggagccatgagagatccaactatctaccgatgcaagccagaggagcat
gtgagaacaggattaaagtacaaggtctatccaacttatgacttcacttgtccaattgtc
gatagtgtagaaggtgtaactcatgctctcagaaccactgaataccatgatcgtgatgat
cagtactacttcatctgcgatgctctcggtcttcgtcgtccacacatttgggaatatgca
cgtctaaacatgacgaacacagttatgagcaagcgtaagctcacctggtttgtcgatgaa
ggacatgtcgagggatgggatgatccaagacttccaactgttcgaggagttatgagaaga
ggattgactgtcgaaggattgaaacaatttattgttgcacaaggaggatcgagatcagtt
gtcatgatggaatgggataagatttgggcgttcaataagaaggttattgatccagttgcg
ccaagatacacagctctcgactccacatctccgcttgtttccatcgaattaacagattca
atctctgacgacacctccaatgtgtctcttcatccaaagaatgctgaaattggaagcaaa
gacgttcacaagggcaaaaaacttttgctcgaacaagtcgatgctgcagctctgaaggaa
ggagaaattgtcacattcgtcaactggggtaacataaagattggaaaaatcgagaagaag
ggcgccgtaataacgaaaatcagtgcaactcttcagttggataatactgattacaagaaa
actacaaaagtgacatggctgggagatgtcaaggctgaggctggaaaaactattccagta
gtgactgctgactatgatcatattatcagcaaagctattattggaaaggatgaagattgg
aagcaattcatcaattttgactctgtgcactacacaaagatggttggagaaccagcaatc
aagaatgtgaagaagggtgatatcattcaaattcaacgcaaaggattctacattgttgac
caaccgtacaatccaaagagtgaactcagcggagttgaaactcctctgcttctcattgcc
attcctgatggacatactggcaaagaagctgagaagccaccgaagggagctccagttagc
gctgctgcttcttccggaggttccgatgctctccaattgtacaattccattgaacaacag
ggtggaattgtcagagatttgaaaacaaaagatgctaaatctcaagctacaaaggatgca
attgctaagcttcttgatttgaaaaagaagtataaggaattgaccggctctgatcacaag
ccaggagctccaccatccgctccagctcctactactccatcgtcttctgaatcgaactcg
gctttgaacatttacaatctgattgaagctcaaggtctattggttagagaactcaaagga
aaagatgccaagtctcaagcaacaaaagatgctatcgcgaagcttcttgaattgaagaaa
caatacaaagaggtcagtggatccgatcacaagccaggtgtaccacctgctgcatctgtt
gcatcagctccagcaccagcacctgctgcaggatcgaccaacgccttggatatctaccac
caaatcgaatcccaaggagctttggttagagaactcaaaggaaaagatgcgaagtctcaa
gcaacaaaagatgctatcgctaagcttcttgctctgaagaaacaatacaaagaggtgact
ggttccgatcataagccaggtgttgttccagtctctgcaccagctccaacccctcttgcc
ggaggagccgatattgcaggtcaaattgaagcacaaggagttcttgtcagagatttgaag
aacaaggattccaaatctcaagaaacaaaggatgctattgcgaaactcctagagctcaag
aagaactataaagaggttactggttccgattacaagccaggccctgctccagcagctgct
cccgcgaaggttacggtaccagctccatcggtctccgggggggatacactttccaagcag
attgatgatcaagcacttcttgtgagagagttgaagatgaaagacgctaaatctcaagaa
accaaggacgccatcgcaaaactgttgcagttgaagaaacagtacaaggatgcgaccggt
tcggattataagccagctccagctcaattggcagcttcagccgccgccgcaccagctcca
gctccagctttcgacgaagctgcgcttctcaaggaaattgaagagcaaggagcagttgtc
cgtgacgcaaaatccaaagatccaaaatcgcaagattccgccgatgccattaacaagctt
ctggctttgaaggctaatttcaagaaagccactggaaaagacttcccagctccatcgaat
gctcaatcgaagaaaggaaagaagaagtaa

DBGET integrated database retrieval system