KEGG   Caenorhabditis elegans (nematode): CELE_ZK1058.2Help
Entry
CELE_ZK1058.2     CDS       T00019                                 

Gene name
pat-3
Definition
(RefSeq) Integrin beta pat-3
  KO
K05719  integrin beta 1
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04145  Phagosome
cel04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:cel00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    CELE_ZK1058.2 (pat-3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    CELE_ZK1058.2 (pat-3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cel04131]
    CELE_ZK1058.2 (pat-3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cel04147]
    CELE_ZK1058.2 (pat-3)
   04515 Cell adhesion molecules [BR:cel04515]
    CELE_ZK1058.2 (pat-3)
   04090 CD molecules [BR:cel04090]
    CELE_ZK1058.2 (pat-3)
Membrane trafficking [BR:cel04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    CELE_ZK1058.2 (pat-3)
Exosome [BR:cel04147]
 Exosomal proteins
  Proteins found in most exosomes
   CELE_ZK1058.2 (pat-3)
Cell adhesion molecules [BR:cel04515]
 Integrins
  Integrin beta subunits
   CELE_ZK1058.2 (pat-3)
CD molecules [BR:cel04090]
 Proteins
  CELE_ZK1058.2 (pat-3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Integrin_beta Integrin_b_cyt Integrin_B_tail PSI_integrin EGF_2 I-EGF_1
Motif
Other DBs
NCBI-GeneID: 175504
NCBI-ProteinID: NP_497787
WormBase: WBGene00003930
Ensembl: WBGene00003930
UniProt: Q27874
Position
III:complement(join(3909329..3909400,3909454..3909740,3910174..3910661,3911221..3911559,3912116..3912552,3912651..3913054,3913672..3913876,3913932..3914129))
Genome map
AA seq 809 aa AA seqDB search
MPPSTSLLLLAALLPFALPASDWKTGEVTGKVVEKSEFPCYSLSRDNYTCSACIQYHESC
AWCGAPMFDEKKPYARCDSRAKLMEHGCPNSYIEDPATKLDITEDSKLSDQGQVESEEEA
VQIKPQEMYVEIRPKSRVRFNVTYRQAVDYPVDLYYLMDLSYSMKDDKQKLSELGDLLAE
RMRTVTKNFRLGFGSFIDKKLMPFIDPRIEKQLSPCPTPCAEPYGFKHQMSLTTNTAKFK
AEVDKAEISGNLDAPEGGFDAVVQALACNKTIGWRERARKMIVFSTDAGFHFAGDGRLAG
VVEPNDGTCHLDREGYYTETLNQDYPSIALLHQMIKDRKANVIFAVTKNNQDLYTQLSNA
LPDVSSSVGVLANDSRNIVDLIEKEYLKISEKIIMVDNANASEGLKLTYRSMCLDGTTLK
DTNVCEGIRVGDEVQFEVTLENTHCIDKRDFVLRIGPSGLDETLIVNVKVLCDCDCERQD
RIVTNSADCNGGDMVCGVCRCKGGNVGKYCECNRPGMSTAALNEKCKRTNESAICEGRGV
CNCGRCECNPRANPEEQISGEFCECDNFNCPRHDRKICAEHGECNCGKCICAPGWTGRAC
ECPISTDSCLSANGKICNGKGECICGRCRCFDSPDGNRYSGAKCEICPTCPTKCVEYKNC
VMCQQWQTGPLNETACDQCEFKVIPVEELPNLNETTPCQFVDPADDCTFYYLYYYDEATD
NATVWVRKHKDCPPPVPVLAIVLGVIAGIVILGILLLLLWKLLTVLHDRSEYATFNNERL
MAKWDTNENPIYKQATTTFKNPVYAGKAN
NT seq 2430 nt NT seq  +upstreamnt  +downstreamnt
atgccaccttcaacatcattgctgctcctcgcagcacttcttccattcgctttaccagca
agcgattggaagactggagaagtcactggaaaagtcgtcgaaaaatcagaattcccatgc
tacagtctgtcacgtgacaattacacatgctcagcgtgcattcaatatcatgaatcttgc
gcgtggtgtggagcaccgatgttcgacgagaagaagccatatgcccgttgtgatagccgt
gccaagctcatggaacatggatgtccaaacagttatatcgaggatccggccacaaaattg
gatatcactgaagacagtaaactctccgatcaaggacaagttgaatctgaggaagaagcc
gttcagatcaaaccacaggagatgtacgtcgaaattcggcccaaatcccgtgttcgtttc
aatgtgacctaccgtcaagccgttgattatccagttgacttgtactatttgatggatctc
tcatattccatgaaggatgacaaacagaaactgtccgaactcggagacttgctcgccgaa
cgaatgagaactgtcacaaagaatttccgattaggattcggttcattcattgacaagaaa
cttatgccattcatcgatccacgaatcgaaaaacaattatctccgtgtccaacaccatgt
gcagaaccatatggattcaagcatcaaatgtcattgacgacgaacacggcaaagttcaag
gctgaagttgataaagctgaaatttctggaaatttggatgctccggaaggaggtttcgat
gctgttgttcaggcgttggcttgtaataaaaccattgggtggcgtgaacgtgctcgtaaa
atgatcgttttctcaactgacgctggattccatttcgctggagacggaagattggcaggt
gtcgtcgaaccaaatgatggaacatgtcatttagatagagaaggatattatactgaaaca
cttaatcaagattatccatcaattgcacttcttcatcaaatgatcaaggatcgtaaggca
aatgtcatttttgctgttacaaagaacaatcaggatttgtatacacaattgtcgaatgca
ctcccagatgtttcatcgtcggttggagttttggctaatgattcaagaaatattgtcgat
ttgattgagaaggaatatttgaaaattagtgaaaagatcattatggttgataatgcaaat
gcttcagaaggactcaagctcacttacagatctatgtgtttggacggaaccacactgaaa
gataccaatgtttgtgagggaattcgtgttggagatgaagttcaattcgaagtaaccctt
gaaaatactcattgtatcgataaacgtgattttgttctccgtatcggaccatctggattg
gatgagacacttatcgttaatgttaaagttttatgcgattgtgattgtgaacgtcaagac
agaattgtgacgaattcggctgattgtaacggaggagatatggtttgtggagtttgtcga
tgcaaaggaggaaatgttggaaaatattgtgaatgtaatagacctggaatgagtactgct
gcgctcaatgaaaaatgcaaaagaactaacgaatcagcaatctgtgagggtcgtggtgtg
tgtaactgtggacgttgtgaatgtaatccacgtgccaatccagaagaacaaatctctgga
gaattctgtgaatgcgacaacttcaattgcccacgacacgatcgtaaaatctgtgcagaa
cacggtgaatgcaactgtggaaagtgtatttgtgcacctggatggactggaagagcctgt
gaatgcccaatttcaactgattcatgcctctctgcaaatggaaaaatctgtaatggaaag
ggtgaatgtatttgtggaagatgtcgatgcttcgattcgcccgacggaaatcgatattcg
ggagcgaaatgcgaaatttgtccgacgtgtccgacgaaatgtgtggaatacaagaattgt
gtaatgtgccagcaatggcagacagggccacttaatgagaccgcctgtgatcagtgtgaa
ttcaaagttattcctgttgaggaattacccaatctcaacgaaactacaccctgccaattt
gtggatccagctgatgattgtacattctattatctctactattacgatgaggccacagat
aatgcaacagtctgggtcagaaaacataaagattgtcctccacctgtccctgtgctcgca
attgtgctcggagtcattgcgggtatcgtaatcctcggaattcttctcttgttgctctgg
aaattgctcacagtacttcatgatagatccgaatacgctactttcaataacgaaaggctt
atggccaaatgggatacgaacgagaacccaatctacaaacaggccacgacaacatttaaa
aatccagtatacgctggaaaagccaactaa

DBGET integrated database retrieval system