KEGG   Caenorhabditis elegans (nematode): CELE_ZK1127.11Help
Entry
CELE_ZK1127.11    CDS       T00019                                 

Gene name
him-14
Definition
(RefSeq) MutS protein homolog him-14
  KO
K08740  DNA mismatch repair protein MSH4
Organism
cel  Caenorhabditis elegans (nematode)
Brite
KEGG Orthology (KO) [BR:cel00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cel03400]
    CELE_ZK1127.11 (him-14)
DNA repair and recombination proteins [BR:cel03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    MutS homologs specialized for meiosis
     CELE_ZK1127.11 (him-14)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MutS_V MutS_III MutS_II AAA_14 AAA_27 Zot
Motif
Other DBs
NCBI-GeneID: 174157
NCBI-ProteinID: NP_495451
WormBase: WBGene00001872
Ensembl: WBGene00001872
UniProt: Q23405
Position
II:complement(join(7065118..7065237,7065281..7065365,7065415..7065505,7066827..7066909,7066956..7067026,7067072..7067283,7067334..7067475,7067521..7067786,7067832..7067901,7067951..7068072,7068148..7068343,7068394..7068720,7068765..7068830,7069113..7069162,7069209..7069417,7069460..7069563,7069610..7069758,7069801..7069966))
Genome map
AA seq 842 aa AA seqDB search
MYSNKSFQRRQRQQVAESRSEEKFSRSLVRLNAQSLLDSSGNNTTTKNVNSDVVIVVMEG
RGSCEGHIGIALHDTCFPEIHLCEFVDSREYTTLKTMINVHEAFDIVIQNGNEERGSTKL
LGEALMTAFPEASLQSISSKYFNSERGERQLQSLMNAEVSTVSEGCLRRTLALGALAVLL
KYIHETRCVFFRVKSLRIKEMGVNDTCMIDFVSWESLEIVDADDASKARKFQMKQKRTLM
SVLNHTVTTNGYRLLRSSVLQPSTDVYLIQSRQEAIEELIGKPQLKDKLRRTLSRAHELD
RVIAMCIQTSTSWTVRESEAKINQIIKLMHTLKVIQGIRTLLHSAKMKSNILIEKTEFLK
DPRFDQIMNILVEKVDDSLLDGKKNSLHLQNTKCYAIRHFVAVQLDLARQTYEEIIRNVE
ETGAREIAEYFHGNSSVRLSFSQSRGFHYTFVTRQAESVTIPRYFLDVFRNRTTVTFNSR
KVIAYNDRLEQVVAEMFLASDVIVCDMIEEMQPMIPVLYYAMDALSSIDFLCGLATYSDL
RDTCKPTFGPSFSISQGRHPILDWDDSEKTITNDTCLTRDRRFGIITGPNMAGKSTYLKQ
TAQLAIMAQIGCFIPANYASLPIFNRIFSRMGHNDELIRNKSAFASEMSDAAAIVQYADK
NSLVVLDELARSTSTEEGIAITYAICEKVLKLQSYTFLATHFLDIAALANYSNAIDNYHF
LPQTDENSTKKHKLLRGQYRGPLYGFELVELSTIPDEVIEHAQSLATELRANVEDTERDY
DSERRRIKVYMNHRFRECAEYFMDTHGEKWKEEKEAIDKMKALRKYLVDELAKIDSQEQM
CQ
NT seq 2529 nt NT seq  +upstreamnt  +downstreamnt
atgtacagtaataaaagtttccaaagacgtcaaaggcagcaagttgcggaatctcgatca
gaagaaaagttctcaagatcattagttcgactaaatgcacagagccttcttgattcatct
ggaaataatacaacaacaaaaaatgtgaactcggatgttgtaatcgttgttatggaagga
cggggaagctgtgaaggtcatattggaatcgccttgcacgacacttgttttccagaaatt
catttatgtgaatttgtagattcaagagaatacacaacattgaagacaatgattaatgtt
catgaggcatttgatatcgtaatccaaaatggaaacgaagaacgaggatctacgaaactt
cttggggaagctttaatgactgcatttcctgaagcttctctacagtctattagttcaaaa
tattttaattctgaaagaggagaacgacagctccagtcactgatgaatgcagaagtttcg
acggtttctgaaggttgcttgcgccgaacattagctcttggagctcttgcagtcttactg
aaatatattcacgaaactcgatgcgtattctttcgtgtaaaatctcttagaatcaaagaa
atgggagtgaacgacacttgtatgattgattttgtctcttgggaaagtttggagatcgtt
gacgccgatgacgcaagtaaagcaagaaagtttcaaatgaaacaaaaaagaacattgatg
tcagttctgaaccatacggttacgacaaatggttatcggttacttcgatcaagcgttcta
caaccttctacagatgtttatttaattcaatctcgtcaggaagcaattgaagagcttatt
ggaaaaccacagttgaaagataaactacgacgcactctatcaagagctcatgagctggat
agagtcattgcaatgtgcattcagacgtccacatcatggactgttcgcgaatcggaagcc
aaaatcaaccagattattaaattgatgcatacgttgaaagttattcagggaattcgaact
cttctgcactcggccaaaatgaaatcaaatattttaattgaaaaaacagaatttctcaag
gatcctcgcttcgatcaaataatgaatattcttgtcgaaaaggttgatgattcacttttg
gatggtaaaaagaattccttacatcttcaaaatacaaagtgctatgctatccggcacttt
gtagctgttcagttggatttggcaagacagacttatgaagaaataatcagaaatgttgaa
gaaactggagcacgagagatcgctgaatattttcatggtaactcgtcggttcgtctttct
ttctctcaatcacgtggattccactacactttcgtgactcgacaggctgaatctgtaaca
attcccagatatttcctagatgtgttcagaaataggactacagtcacattcaattccaga
aaagttatcgcatataatgatcggctagagcaagttgtagctgaaatgtttttggcgagt
gatgtaattgtgtgtgatatgattgaagaaatgcaaccaatgatacctgttctctattat
gcaatggatgctctttcaagtattgacttcctatgtggtcttgcaacttattcggatcta
cgtgacacatgtaaacctacatttggaccatcattttcaattagtcaaggacgtcatcct
atcctggactgggatgattccgagaaaacaatcacaaacgatacgtgtctgacaagagat
cgtcgtttcggaattattacgggtccaaatatggctggaaagtcgacatatctgaaacaa
actgcccaactggcaatcatggcacagataggatgcttcattccagcaaactatgcttcg
ttgccaatttttaatcgtatcttctccagaatgggtcataacgacgagttgatcagaaat
aagtctgcatttgcatctgaaatgtcagatgcagctgcaatcgtacagtatgccgataaa
aactcacttgtagttcttgatgagctagcacgaagcacgtcgactgaagaaggcatcgcc
atcacctatgcgatttgtgagaaagttctaaagttacagagctataccttcctggctaca
cattttctcgatattgcggctctcgccaactattcaaatgcaattgacaattatcacttt
cttccacaaactgatgaaaattcgacgaaaaagcacaagttgttacgtggacaatataga
ggaccattatacggtttcgagctggttgaactctcaacaattcccgatgaagttatcgag
catgctcaatcactagcaaccgaacttagagcaaatgtcgaggacacggagcgagactat
gactcagaacgccgtaggatcaaagtctacatgaaccatcgtttcagagaatgtgctgaa
tattttatggatacgcacggcgagaaatggaaggaagagaaggaagctattgataaaatg
aaagctcttcgaaaatatttggtcgatgaattagccaagattgacagtcaggagcaaatg
tgtcaataa

DBGET integrated database retrieval system