KEGG   Caenorhabditis elegans (nematode): CELE_ZK1251.1Help
Entry
CELE_ZK1251.1     CDS       T00019                                 

Gene name
htas-1
Definition
(RefSeq) Histone H2A
  KO
K11251  histone H2A
Organism
cel  Caenorhabditis elegans (nematode)
Brite
KEGG Orthology (KO) [BR:cel00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cel03036]
    CELE_ZK1251.1 (htas-1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cel04147]
    CELE_ZK1251.1 (htas-1)
Chromosome and associated proteins [BR:cel03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    CELE_ZK1251.1 (htas-1)
Exosome [BR:cel04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CELE_ZK1251.1 (htas-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histone Histone_H2A_C CBFD_NFYB_HMF StbA
Motif
Other DBs
NCBI-GeneID: 191549
NCBI-ProteinID: NP_501718
WormBase: WBGene00014240
Ensembl: WBGene00014240
UniProt: Q23429
Position
IV:complement(join(9683016..9683375,9683444..9683521))
Genome map
AA seq 145 aa AA seqDB search
MARLKQRPNRILNTSTKTSSAKKKKKRISRSTRSGLTFPVGRIHRKLRETTRGKQRISAG
ASVFMAATLEYLTTELMEMSAIAANESKKSRVTPRHLHLAIYGDQETAQLLDKVTLPQGG
VTPMPIHPSLLPKKKAKEDDKENNS
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atggctcgtctcaaacaaagaccaaatcgaattctcaatacatcgacgaaaacatcatcc
gcgaagaaaaagaaaaagagaatcagccgctcgacacgttctggtttaacttttccagtc
ggaagaattcatcgaaaacttcgtgaaactactcgtggaaaacaaagaatttcagcaggt
gcatctgtttttatggctgctacacttgaatatttaactaccgaacttatggaaatgtct
gcaatcgcggctaatgaaagtaagaaatcgagagtcacgccacgtcatcttcatttggca
atttatggagatcaagaaaccgcacaactgcttgataaggttactctgcctcaaggagga
gttacaccaatgcctattcatccatccttgcttccaaagaagaaagcaaaagaagatgac
aaagaaaataattcttga

DBGET integrated database retrieval system