KEGG   Caenorhabditis elegans (nematode): CELE_ZK1251.3Help
Entry
CELE_ZK1251.3     CDS       T00019                                 

Gene name
ZK1251.3
Definition
(RefSeq) Uncharacterized protein
Organism
cel  Caenorhabditis elegans (nematode)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Steroid_dh DUF1295 PEMT
Motif
Other DBs
NCBI-GeneID: 191550
NCBI-ProteinID: NP_501719
WormBase: WBGene00014241
Ensembl: WBGene00014241
UniProt: Q23431
Position
IV:join(9683664..9684119,9684168..9684473)
Genome map
AA seq 253 aa AA seqDB search
MLYAIIIIGSWLMTTCGIFVFLTLSNTEKPLGYGRYSDSLATTRTLPPTISWMIQGFPSF
IIPFYLYWTNQHLTEYGSFLTCLMTFHYAYRSFVYPFIINSDNQSPVKIVIMAFGFSVLN
GFIQGTWNAFYQPEFDTLHPKFFVFLGAWLFVIGFITHCVSDLHLITLRNDYLNSYSIPR
GHYFEYISCPNYFGECLQWIGYALAARSFPAIAFAFFIVCNLAPRAMSHHKWYQKMFGEQ
YPRDRHALVPGVW
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgctctacgcaataatcataattggctcatggctcatgacaacttgcggaatttttgtg
tttttgactttgtcaaacacggaaaaaccattaggatatggtcgatacagtgattcattg
gccacaactcgaacacttccaccgactatttcatggatgattcaaggatttccatcattt
attattccattctatttatactggacaaatcaacatttgacagagtatggatcatttctg
acatgtcttatgacttttcactatgcctatcgttcatttgtctatccattcattatcaac
tcggataatcagagtcccgtcaaaatagtgataatggcttttggattctctgtgttaaat
ggatttattcaaggaacgtggaatgcattttatcaacccgaattcgatacactacatcct
aaatttttcgtatttcttggggcttggctgttcgtgattggattcataactcattgcgtt
tctgatcttcatctcatcactcttcgcaatgattacctgaatagttacagtattccacgg
ggacactatttcgaatacatttcttgtccaaattattttggtgaatgcttgcaatggatc
ggttatgcactggctgctcgtagttttccggcaattgccttcgcattcttcattgtttgc
aatctggctccacgagcaatgtcacatcataaatggtatcagaagatgtttggagaacaa
tatccacgtgatcgtcatgctttggttcccggagtttggtag

DBGET integrated database retrieval system