KEGG   Caenorhabditis elegans (nematode): CELE_ZK430.5Help
Entry
CELE_ZK430.5      CDS       T00019                                 

Gene name
ZK430.5
Definition
(RefSeq) Uncharacterized protein
  KO
K02365  separase [EC:3.4.22.49]
Organism
cel  Caenorhabditis elegans (nematode)
Brite
KEGG Orthology (KO) [BR:cel00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:cel01002]
    CELE_ZK430.5 (ZK430.5)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cel03036]
    CELE_ZK430.5 (ZK430.5)
Enzymes [BR:cel01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.49  separase
     CELE_ZK430.5 (ZK430.5)
Peptidases [BR:cel01002]
 Cysteine Peptidases
  Family C50: separase family
   CELE_ZK430.5 (ZK430.5)
Chromosome and associated proteins [BR:cel03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   Separase
    CELE_ZK430.5 (ZK430.5)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_C50
Motif
Other DBs
NCBI-GeneID: 191319
NCBI-ProteinID: NP_494778
WormBase: WBGene00022741
Ensembl: WBGene00022741
UniProt: Q23491
Position
II:join(4405864..4405997,4407492..4408206,4408268..4408430,4409285..4409375,4409430..4409693,4410401..4410632,4412476..4412598,4412645..4412943,4412990..4413887,4413936..4414114,4414592..4414687,4414736..4414842,4415966..4416142,4416201..4416553)
Genome map
AA seq 1276 aa AA seqDB search
MHFLSTPDKNSNCFSKKVNSANNTQNFAKGMGNHVGNGSRQAETFKKSNEKLIDKLKTLR
MDVNRSVISFVERTTNFQQDSKIDVTEPTNAHSLEKLTRFTSHYVSSECFDGLGSIQKMM
QNMFNIWQTLRRNAMKCNLEVRRFFAAIPAKLCFFYFYTGELCTAVACLIDFVDLAESTT
AMEAALRWLMFLGETELIEKKLTKWKVDETSEDMISATRYAISYMNQPDSRVEMLDKLIK
LRNKIEKDDDKSSRRKFDLASYIFWLCSTLSNVPVGKSLNECDFPDRLSHIKNAVCKFES
IIYVEAPGFLPYQSGTSVNASIWSILEENWRGNSLGYVSIGSTIAWYFELRREWAHVNVT
TAQTSDSIILQMTNTLAYNVNLIEDFDYEDIAKLMRGSLINLLSLNTAKDGNSTMKETVM
QSEARTTDTGESYQSAPKTQNTNMIILDDQLEGPDMLNEKVFHDVVLSCTCNICVIYHSS
SSFATEYMMSFMIYSNFSQLAIKHFNDEFALIRKRELLRESQIMMHGDSSIQPKPNIIQH
EIFGMCVIRWLTKNLDSKECANETTMEVFKNALNIVAYLKYRTTDLFLTLRQLGRQLEFP
MECNFSWIQPIIRKPRVKPTFEGAGSISRAVSPIGRRAKLVKKVTTEPFDSQRFENNRLT
MQREMQYFAHILYREWRCRMYSYVGKTSKSSWEAAYGWAESTNIGSRNAQQEQLGKCKSG
LVTIPGVHHFNSCGQNMPDDMTLIQIVMADDKTIYLVKLHADRDPIIMPLAHYHQAIEVM
DKFTYLLEEDRQIVSNHEKYKFEECWDRRKIVDCQMKKCVENTQKHFLGAAASLLLPSGR
LGPNATALAIKMYNMAKGGLLPGEAKELVYQSKFIHPKTWKSLVLRYCEMRGIDNKSKSQ
LLLLRKDGFNAMKQDQTIPASSKIYTHLVICPYLSQFCWERLPIFAKFPYVVRHISIHSA
FSQLDDMRNQNKQIPLNIGLENAFYILDPDNNLNGTKRRMLKYINKFNWEGSVGSAPKLT
EVTDALSKRDAFFYFGHGSGSSVVTQSLIRQTTCNAISFLMGCESVRTIPQAHGFDGTSV
IQDYAMAKCPSLVGCLWDVQVVAKHTSIGNNGKENLPITTGRMISYSKKPKIRETEPNSS
NLILASNYNNITSKASLSQEPIKLKETTKIQKETVSKTPKQKSLASNQILTLRSETMNQE
VPRKAITETRSKVQKAPPHPTASQNEEEKDNLKRTRKRKLLVSTIPNFCKEHGAKKPRTT
RPSSRLIKAFHVVQKS
NT seq 3831 nt NT seq  +upstreamnt  +downstreamnt
atgcatttcctcagcacaccggacaagaacagcaattgtttcagcaagaaagtcaatagt
gcaaacaatacccaaaattttgcaaagggaatgggaaatcacgttggaaacggatcacgc
caggcagaaactttcaaaaaaagtaacgagaagttaattgacaagctgaagactctgcgc
atggatgtaaacagaagtgttatcagtttcgttgaacggactacgaatttccaacaggat
tccaagattgatgtcactgaacctaccaacgcacattctctcgaaaaattgactcgattc
acctcgcactacgtctcatcagagtgcttcgacgggcttgggagcattcaaaaaatgatg
cagaacatgttcaatatttggcaaactcttcgaaggaatgctatgaagtgtaacctcgaa
gtaagacggttcttcgctgccatccccgcaaagctttgttttttctacttctacaccgga
gagctgtgcacagcagttgcatgtctcattgactttgttgatttagcagaaagcacaacg
gctatggaagccgcacttcgatggctgatgtttcttggtgagaccgaactgattgagaag
aaattgacaaaatggaaagtcgatgaaacatcggaagatatgatctcagcaacacgatac
gcaatcagttacatgaatcaaccggacagtcgcgtggaaatgctcgataaactaataaag
ctacgtaataaaatcgaaaaagatgatgataaatcctctcgtcgaaaatttgatttggct
tcgtatattttctggctatgctcaacgctgagtaatgtgcccgttggaaagtcactaaac
gaatgtgattttcctgatcggttgtcacatatcaaaaatgcagtttgtaaattcgaatca
ataatctacgttgaagcccctggtttcctcccctatcaatctggcacttcggtgaatgca
tcaatctggtcaatcctcgaggaaaactggcgtggaaatagccttggttatgtgtctatt
ggcagcacaatcgcttggtactttgaactgagacgagaatgggctcacgttaacgtcacc
actgctcaaactagtgattcgataattcttcagatgacaaacacattagcctataatgtg
aatttaatcgaagattttgactatgaggacatcgccaaattaatgagagggtctcttata
aacttgctatccttgaatactgcaaaagatggaaatagtacaatgaaggagacagtaatg
caatcagaagcacgtacaacggatactggagaatcatatcaaagcgccccaaagacacaa
aatacaaatatgatcatattggatgatcaattggagggtccggatatgcttaacgagaaa
gtgttccatgatgttgtcttgtcctgcacctgcaatatttgcgttatttatcattcaagc
agctcgtttgccacggaatacatgatgtctttcatgatttactcgaatttttcacaacta
gccatcaagcatttcaacgacgagtttgcactcatcagaaagcgtgaattactgagagaa
agtcagattatgatgcatggcgacagtagcatacaaccgaagccaaacattattcagcat
gagatttttggaatgtgtgtgattcgatggctaacaaaaaacttggattcaaaggaatgc
gcaaacgaaaccactatggaagttttcaagaacgcgctgaacattgtggcatatttgaaa
taccggacgacagatcttttcttaacattgagacagcttggaagacaacttgaatttcca
atggaatgcaactttagctggattcagccaattattcggaagcctcgtgttaagcctaca
ttcgagggagctggcagtatttctcgtgcagtttctcctatcggacgccgtgctaaactg
gtgaagaaagtgacaactgagccttttgattcgcaacggtttgaaaataaccgacttact
atgcaacgagaaatgcagtattttgctcatattctctacagagaatggcgttgtcgaatg
tactcgtacgtcggaaaaacatccaaaagttcttgggaagctgcttacggatgggccgaa
tcaacaaatattgggtctcgtaatgctcaacaggaacaactggggaagtgcaaaagtgga
ctggttactattccgggagtacatcacttcaattcctgtggtcaaaatatgccagatgat
atgacgcttattcagatcgtaatggctgatgataagactatatacttggtcaagctgcat
gcggatcgtgacccgattatcatgccgttggctcattatcatcaggctatcgaagtaatg
gataaattcacgtatttactggaagaagatcgccagattgtcagcaatcacgaaaaatat
aaattcgaagaatgttgggatcggcggaaaatcgttgattgtcaaatgaaaaaatgcgtt
gaaaatacacagaagcattttctcggtgctgcagcgagtcttctgttgccttctggacgt
ctgggccccaatgcaacagcgttagcgataaaaatgtataacatggcaaagggtggactc
ttaccgggagaagctaaggaattggtttatcaatccaagtttatacacccaaaaacatgg
aaatcacttgttctccggtactgcgagatgagaggtatcgataataaatcaaaatcgcaa
ctccttctgttgcgcaaggatggttttaatgctatgaaacaagaccaaacgattcccgct
tcgtcaaaaatatatacacaccttgtcatttgtccttatttgtcacaattctgctgggag
cggttgccaatttttgctaaatttccatatgtggtacgacacatttcaattcactcggct
tttagccagttggacgacatgagaaatcaaaacaaacagatcccgctaaatattggtttg
gaaaacgcgttctacatacttgatccagataacaatttgaacggaacaaagaggcgaatg
ctgaaatacattaataaattcaattgggaaggaagtgttggctcggcaccaaaattgacg
gaggttaccgacgcgttgtcgaagcgcgatgcatttttttactttggacatggctcggga
tcttctgttgtgacacagtctcttatcaggcaaacgacttgcaatgcaattagtttttta
atgggctgtgagagcgttcgaactattccgcaagcccacggctttgatggaacatctgtg
attcaggattacgcgatggcaaaatgtccatcgcttgttggatgcttatgggatgtacag
gttgtcgcaaaacacacttcaatcgggaataacggcaaggaaaacttacctataactaca
ggcagaatgatttcttattcaaaaaaaccgaagataagagaaactgagccgaattcttcg
aatcttatccttgcatcaaattataataatatcacttcaaaggcttcactgagtcaagaa
ccaattaagttgaaggaaacaacgaaaattcaaaaggaaactgtgtccaagactccgaag
cagaaatctctagcttcaaatcaaattcttaccttgcgttctgaaactatgaatcaagag
gttcccagaaaagccataacagagacacggagcaaagttcagaaggcacctccgcatcct
acagcctctcaaaatgaagaggaaaaagacaatttgaaaagaacaagaaaaagaaaactg
cttgtttcaaccattcctaatttctgcaaagaacatggagcgaagaaacctagaactact
cgaccgagttctagattgatcaaagctttccacgttgttcagaaaagttaa

DBGET integrated database retrieval system