KEGG   Caenorhabditis elegans (nematode): CELE_ZK632.12Help
Entry
CELE_ZK632.12     CDS       T00019                                 

Gene name
ZK632.12
Definition
(RefSeq) Uncharacterized protein
  KO
K23858   
Organism
cel  Caenorhabditis elegans (nematode)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FYVE PH IQ_SEC7_PH FYVE_2 PH_13 PH_16
Motif
Other DBs
NCBI-GeneID: 176397
NCBI-ProteinID: NP_499183
WormBase: WBGene00014019
Ensembl: WBGene00014019
UniProt: P34657
Position
III:join(9830838..9830853,9830901..9831293,9831773..9831981,9832030..9832170,9832217..9832258)
Genome map
AA seq 266 aa AA seqDB search
MVDRLVNSEVNSRRMANVEQCFGKMGEQLSVFGRVLVGEGVLVKMCRKKPKQRQFFLFND
ILVYGNIVISKKRYNKQRILRLEGVQVEDLEDDGIEKHGWIIKTPAKSFAVYAATETEKR
EWMLHIERCVTDLLERGNKQAATAHAAVWVPDGEAVKCMVCGKTQFNLVQRRHHCRNCGR
VVCGACSSRTFRIDNVHKKPVRVCDHCFDSLSSATPGQEESEPKTGNRLHHEDSSSDSED
EVNGSGRSSNESRPTFYREDVQQPAT
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atggttgatcgacttgtgaatagtgaagtgaattcccgtcgaatggctaacgtagaacaa
tgctttggaaaaatgggagaacaattgtcggtattcggacgagttcttgtcggagaaggt
gttcttgtgaaaatgtgccgaaagaaaccgaagcaacggcaattcttcttgttcaatgat
attcttgtatatggaaacattgtgatttcgaaaaagcgatataataagcaaagaattcta
agattggaaggtgtacaagtagaagatctggaagacgatggaattgagaaacatggatgg
attattaagacacctgcaaaatcgtttgcagtttatgcagcaactgaaactgaaaaacga
gaatggatgttgcatattgagagatgcgttacagatctccttgaaagaggaaataagcaa
gccgcgactgctcacgcagctgtatgggttcccgatggtgaagcagtgaagtgtatggtc
tgcgggaaaactcaattcaatctggttcaaagaagacatcactgcagaaattgtggacgt
gtcgtgtgtggcgcctgctcatcgagaacattccgtattgacaatgtacataagaagcct
gtccgagtttgtgatcattgctttgacagtctgagtagtgccacaccaggacaagaagaa
agtgaaccaaaaacgggaaatcgcttgcaccatgaggattcctcctcggatagtgaagac
gaggtcaatggtagtggacgatcgagtaatgagagccggccaacattctaccgtgaggac
gttcagcagccggcaacatag

DBGET integrated database retrieval system