KEGG   Caenorhabditis elegans (nematode): CELE_ZK637.11
Entry
CELE_ZK637.11     CDS       T00019                                 

Gene name
cdc-25.3
Definition
(RefSeq) M-phase inducer phosphatase cdc-25.3
Organism
cel  Caenorhabditis elegans (nematode)
SSDB
Motif
Pfam: Rhodanese
Other DBs
NCBI-GeneID: 176260
NCBI-ProteinID: NP_498972
WormBase: WBGene00000388
Ensembl: WBGene00000388
UniProt: P30634
Position
III:complement(join(8916504..8916983,8917378..8917747,8917795..8917895))
AA seq 316 aa
MCVDVPCENCIVRNDGLRLKCSECAEGSSKLFPRQNRQHSSAISHISNSSPPTRKRSIDG
GYTSGTDSANTSEIVIKKRLTFSKKSHSTSEIETWNAHLQVDYHLETVTPSCSTVYQKIT
SETLIEIMQKLSQIEFMQKYILIDCRYDYEYNGGHIKGAQSLFNPETAADFFFNKDGSKK
INRIPIFYCEYSQKRGPTMANNLREVDRKLNSNIYPRCDYEEIYLLEGGYKNFYAFTRGL
EKEQRVQLCEPDNYVIMFDDRYKAELRKHQFHKKNVSKPMKKWSSTTSVISILTTSGTRI
STLRQTCDPIHEHDAH
NT seq 951 nt   +upstreamnt  +downstreamnt
atgtgcgttgacgttccatgtgaaaactgcattgttcgcaatgacgggctccggctgaaa
tgttctgaatgtgctgaaggatcctcgaagctattcccaagacaaaaccgtcaacactct
tctgcgatcagccacatctccaactcatcgccacccactcggaaacgaagcattgatgga
ggatatacatctggaacggattctgcgaatacttctgaaattgtgataaagaaaagacta
actttctcaaaaaagagccattcaacttcggaaattgagacatggaatgcccatcttcaa
gtggattatcatttggaaaccgtgacgcctagctgttctaccgtataccaaaaaatcact
tctgaaacgttaattgaaatcatgcagaagctatcgcaaattgagtttatgcagaaatat
attctaattgattgccgatatgattatgaatataatggagggcatattaagggagctcaa
agcctgttcaatccagaaactgctgcagacttcttcttcaacaaagatggttccaagaaa
atcaaccggatacccattttctactgtgaatacagtcaaaaacgtggaccaaccatggcg
aacaaccttcgggaagtggacagaaaactgaattcaaatatctatccgagatgtgattat
gaggagatttatttgttggaaggaggttataaaaacttttacgctttcacgcggggatta
gagaaggaacaaagagtacaactctgtgagccagataattatgtaatcatgtttgatgat
cgttataaggctgagcttcggaagcaccagttccataagaagaatgtttcgaagccaatg
aagaaatggagttcaacaacatctgtgatatctattctaacaacttctggaactcgtatt
tcgacacttcgtcagacatgtgatcccatccatgagcacgatgcgcattaa

DBGET integrated database retrieval system