KEGG   Caenorhabditis elegans (nematode): CELE_ZK669.1
Entry
CELE_ZK669.1      CDS       T00019                                 

Gene name
spv-1
Definition
(RefSeq) Spermathecal Physiology Variant
  KO
K20644  Rho GTPase-activating protein 29/45
Organism
cel  Caenorhabditis elegans (nematode)
Brite
KEGG Orthology (KO) [BR:cel00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cel04131]
    CELE_ZK669.1 (spv-1)
Membrane trafficking [BR:cel04131]
 Others
  Rho GTPase associated proteins
   Rho GTPase-activating proteins
    CELE_ZK669.1 (spv-1)
SSDB
Motif
Pfam: RhoGAP C1_1 FCH DUF5721 Zf_RING Prok-RING_1
Other DBs
NCBI-GeneID: 174278
NCBI-ProteinID: NP_495666
WormBase: WBGene00014051
Ensembl: WBGene00014051
UniProt: G5EF80
Position
II:complement(join(7913287..7913307,7913998..7914080,7914242..7914391,7914545..7914957,7915006..7915346,7915394..7915552,7915601..7915904,7916204..7916346,7917013..7917093,7924191..7924268,7924713..7924892,7924937..7925125,7925172..7925374,7925538..7925643,7926516..7926588,7927458..7927545,7928037..7928174,7928505..7928655))
AA seq 966 aa
MSSTSSICSSNDADFIVDTRIPASIRRDIDRFSVFINRLRSTLDLNSSVVDGESMCVNVH
ASLEMVSESMRDLFKYSQFKTNPIILLSLQLVQAVKDLKFDTCSVDTTPVLNIIDQLESA
VLNIILNRHIVSSVHHTPSRSSTLGRWKQNNSTDSYLRQSGPLNSVSQTLQRRHSTHQTN
PDPNDQSTEKVMEIDKLLISRTDGVDVAFERTKAWSTYSKDVISYVRARIQLEQDHARKV
HTLVDTSRRDINKPFMPLREIFENSFDTEVEMVTHTKETTEHLKDRVVEALDARRKEHDT
VRNALKVEWTKATKSLHDCEESYEKSKITLRMREEALKKARESCLRTESSPPEREASRRR
RDLEKKSRAVEEAMIKKEEAERQVVSITAELRKKRRDIDKTKESVVERLRELIFQCEQTT
KACTVHYFTSLAALWARLPGAFHELSNATRDYQPGTEYMAFLQTLPTRAASSSSLVRSDR
SIDEGVASCDGSSSLTSLRRNAINPDDEGALPDTKRHKKTSYAGRTFDNHEISTAAQSHH
IQRTVQPSKCSACDTLSILYTVQCIDCGGQWHKACFPRIQQVCGQAAKLVDRRTSIFGVP
LKGLLEHQNRHIPLIIEKSIDQLQRRGLRAKGIYRTCGVKSKIEEICNAFERSSSDDEVC
LDNENPMNLASVVKLYLRKLPEPLLTFELYDDFVRLGTECCSAQASGSNCEEERVEQLRQ
LARKLPVHNYETLKFIMLHLNRVSWFHEVNLMSTSNLSTVIAPSLIWMSPKRIDHTSAIM
HTQYTNKAIEVMIRNSYHIFGMDRQADWQSFFSRYSVEEPPKEEEEEDCGNESDIEDDIE
DLDEQDRSDEDDDEEIFLPPTPDILKTTRKPVEQTTSLPNPKLPVERISSGRRSNNNEPP
TIVQRRTNDISRRSDMGDKRKSYTTSIVIAPRDGSPDHVDQIQIIERDVYDKGASLEQDK
VESTRL
NT seq 2901 nt   +upstreamnt  +downstreamnt
atgtcgtcgacgagcagtatatgctcttcaaatgatgccgatttcattgttgacaccaga
attccggcatcaatacgtagagatattgatcgattttcagtttttataaatcgacttcgg
tcaactttggatctcaattcttcggttgttgacggtgaatcaatgtgtgtaaatgtgcat
gcatcattggaaatggtgtcagaatccatgcgggacttgtttaaatactctcaattcaaa
acaaatcccatcattttgctgtctcttcaacttgtgcaagccgtcaaagacttgaaattt
gatacgtgctctgtggatacgactccggttctgaacattatcgatcagctggaatcagct
gttttaaacatcattctaaaccgtcatattgtttcatcggttcatcatacgccgagtaga
agttcaacgttaggtcgctggaaacaaaataattccactgattcatatctacggcagagt
ggtcctcttaactcagtatctcaaacattgcaacggagacattccactcatcaaaccaat
ccggatcccaatgatcagtcgactgaaaaagtgatggagattgataagctgctgatctca
agaacagatggtgtagacgtggcttttgaaagaacaaaagcttggagtacatacagtaaa
gatgttatatcctacgtaagagcaagaatacaattagaacaggatcatgcaagaaaggtt
catacactggttgacacttcgaggcgagatatcaataaaccattcatgccgttgagagaa
atattcgaaaattcatttgacacggaagttgaaatggtaacacatacaaaagaaacaacg
gaacatttgaaagatcgggttgtagaagcattggatgctcgaagaaaagaacatgatacg
gttagaaatgctttgaaagttgaatggacaaaagctacaaaatcattgcacgattgtgaa
gagtcatatgaaaaatcgaaaatcactttacggatgcgagaagaagctttgaaaaaagcg
agagaaagttgcctccgaacagaaagttcacctccagaacgagaagcatcaagaagaaga
agagatttagaaaagaaaagtcgagctgtagaagaagccatgattaagaaggaagaagct
gagcgacaggtggtctcaataacagctgaattgagaaagaaacgaagagatatagacaaa
accaaggaaagcgtagtcgaacgacttcgtgagctcatattccagtgtgagcagactaca
aaagcgtgcacagttcattattttacgtctctggcggcgctttgggcgcgattgccaggt
gcatttcacgaattgtcgaatgcaacaagggactatcaaccgggcaccgagtacatggca
ttcctacaaaccctgcccactcgagctgccagtagtagcagtcttgtcagatcggatcgc
tcaattgacgagggtgtagcatcatgtgatggttcatcatctctaacatctcttcgaaga
aacgcaataaatcccgatgacgaaggagctcttccagacaccaaacgtcataaaaagacg
agttatgccggtcgaacatttgataatcatgagatttcaacggcagcacaatctcatcac
attcaacgaactgtgcaaccgtcgaaatgttctgcttgtgacacattgtccatcctgtac
acagttcagtgtatagattgtggtggacaatggcataaagcttgctttccaaggattcaa
caagtttgcggtcaagcagcaaaattagtggatcgtcgaacatcaatatttggagttcca
ttgaaaggacttttagagcatcaaaatagacatatcccgttaattattgaaaaaagtatt
gatcagttacagaggagaggtttacgagctaaaggaatatatcgaacatgcggtgtaaaa
tcaaaaatagaagaaatctgcaacgcatttgaaagaagttcatcagacgatgaagtttgt
ttagacaatgaaaatccaatgaatcttgcttccgtcgtcaaattgtatctacgaaaacta
ccagaaccacttctaacttttgaactttatgatgattttgtgagattaggaacagaatgt
tgttctgcacaagcatctggatcaaattgtgaagaagaaagagtagaacaattgagacaa
ttggctcgaaaactaccggtgcacaattacgagacactcaaatttataatgctccatttg
aacagggtttcctggttccacgaagtgaatcttatgagtacttcaaatttatccacagta
attgctccatccttaatttggatgtctccaaaacgaatagatcatacttctgcaattatg
catactcagtatacaaacaaagcaattgaagtgatgattcgaaactcatatcacattttt
ggaatggatcgacaggccgattggcaaagtttcttttcgagatatagtgttgaagagcca
ccaaaagaagaagaagaagaagattgtgggaatgaatcagatattgaagatgacattgaa
gatttggatgagcaagatagatctgatgaagatgatgatgaagagatattcttgcctcca
actccagatattctgaaaacaacgaggaaacctgtggagcagacaacatctcttcctaac
ccaaaattacccgttgaaagaatatcaagtggtagacgatcaaataacaatgagccacca
acaatagttcaaagaaggaccaatgatatttcaagacgaagtgatatgggtgataagagg
aagagttatacaacatcaattgtcattgcacctagagatggatcaccagatcacgttgat
caaattcaaataatcgaacgggatgtatatgacaaaggagcttcattggagcaagataag
gttgaatcgacacgtctttga

DBGET integrated database retrieval system