KEGG   Caenorhabditis elegans (nematode): CELE_ZK675.3
Entry
CELE_ZK675.3      CDS       T00019                                 

Gene name
best-23
Definition
(RefSeq) Bestrophin homolog
  KO
K22204  bestrophin, other
Organism
cel  Caenorhabditis elegans (nematode)
Brite
KEGG Orthology (KO) [BR:cel00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cel02000]
    CELE_ZK675.3 (best-23)
Transporters [BR:cel02000]
 Other transporters
  Pores ion channels [TC:1]
   CELE_ZK675.3 (best-23)
SSDB
Motif
Pfam: Bestrophin
Other DBs
NCBI-GeneID: 6418643
NCBI-ProteinID: NP_001122668
WormBase: WBGene00014989
Ensembl: WBGene00014989
UniProt: A5JYR2
Position
II:complement(join(7904765..7904868,7904918..7905026,7905133..7905346,7905391..7905482,7906359..7906535,7906729..7906920,7906966..7907044,7907093..7907215,7907459..7907586))
AA seq 405 aa
MTISYSDTFLKLLFRWKGSLWKAIWKHLLIFLTMYYIINAYYRFGMTKEQQNEFIKYVML
VDGWTKEIPLTFLLGFYVAMIVRRWWDCCQLISWPDHLLYNVSALIRGQDPETRIIRKTI
ARYTILTSVLAWRSISLRVLARYPTDDHLVDSGLMTKEEMVMFKSILVHVDPHQKWWVPL
NWIQTMMVRCFEKGTLTHTNELRVLLDALEKYRNGFFQLFIYDWIAIPLVYTQVSTISVY
GYFLFALIGRQYPSKNENEEIVDVYVPIFTILQFLFYVGWLKVGEDLMFPFGADDEDFEF
NYILERNLEVSMLIVDELHNQVPPVYVESLDDEIRLLHTSASSKLSNHPQRQHLRKLKFN
VDAMQVQAVPGNHLNERDVSVSTTSKLSFADLENLANGPRNIPKF
NT seq 1218 nt   +upstreamnt  +downstreamnt
atgaccatctcctactcggacacgttcctcaaactattattccgatggaaaggttcatta
tggaaagcaatatggaaacatcttcttatttttctcacaatgtattacattatcaatgca
tattacaggtttgggatgacaaaagaacaacaaaacgaatttataaaatatgtgatgttg
gttgatggatggacaaaggaaattccattaacattcttattaggtttttatgttgctatg
attgtgagaaggtggtgggattgttgtcaacttatcagttggccagatcatcttctctac
aatgtatctgcacttattcgaggtcaagatccagagacgcgaataatcagaaaaacaatt
gcacgatatacaattttaacatcagttcttgcatggaggagcatatcgttaagagttctt
gcaagatatccaacagatgatcatttagtagattctggattaatgacaaaagaagaaatg
gtcatgttcaaatcaattctagttcatgttgatcctcaccagaaatggtgggtcccattg
aattggattcaaacaatgatggttcgatgttttgaaaagggcacattaacacatacaaat
gaacttcgtgtccttctggatgcattggaaaagtatcgaaatggcttttttcagttgttc
atttacgattggattgcaattcctcttgtgtatacgcaggtttctacaatctcagtctac
ggatattttctgtttgcactcataggaagacagtacccaagcaaaaatgaaaatgaagaa
atagttgatgtatatgttccaattttcacaattctacaatttttattctatgtcggatgg
ttaaaggtcggagaggatctgatgttcccgtttggggctgatgatgaggatttcgagttt
aactacatactggaacgaaatttggaagtttcaatgttaatagtcgatgaactacacaat
caagtaccacctgtttatgttgaaagtttggatgatgaaattcgtttacttcatacaagt
gcatcgtcaaaactatcaaatcatccacaacgacagcatcttcggaaattaaaattcaat
gtagacgcaatgcaagtgcaagcagttccgggaaatcatctaaacgaacgagacgtttcc
gtttcaacaacttcaaaactttcattcgctgatctggaaaatttggcaaatggtcctaga
aatattccaaagttttga

DBGET integrated database retrieval system