KEGG   Caenorhabditis elegans (nematode): CELE_ZK688.2
Entry
CELE_ZK688.2      CDS       T00019                                 

Gene name
best-24
Definition
(RefSeq) Bestrophin homolog 24
  KO
K22204  bestrophin, other
Organism
cel  Caenorhabditis elegans (nematode)
Brite
KEGG Orthology (KO) [BR:cel00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cel02000]
    CELE_ZK688.2 (best-24)
Transporters [BR:cel02000]
 Other transporters
  Pores ion channels [TC:1]
   CELE_ZK688.2 (best-24)
SSDB
Motif
Pfam: Bestrophin
Other DBs
NCBI-GeneID: 176110
NCBI-ProteinID: NP_498717
WormBase: WBGene00022797
Ensembl: WBGene00022797
UniProt: P34672
Position
III:join(7901035..7901213,7901573..7901707,7902141..7902630,7902682..7902974,7903025..7903135,7903186..7903281,7903326..7903817,7904133..7904235)
AA seq 632 aa
MTINYNLAVSTSKPWTLFKLLLKWRGSIWKAVILELAVWLVLYGILSVIYRTALNPGQQR
TFERIVQYCDSRLSYIPLNFMLGFFVTAVVNRWTYLYQIIGFIDNIGLMAAEYVRGRTEQ
ARMYRRNIVRYCELAQVLVFRDISMRTRRRFPTLDTVVAAGFMMPHEKDRFDEIQYKYSK
YWVPFQWAFSLTYEARKKGLIESDYYQVVVQDEIKKFRTGLAWICNYDWVPIPIMYPQLV
CLAVHTYFLVCLLARQYVVSEHADNKTEIDLYFPIMSTLQFIFYMGWMKVAEAMLNPFGE
DDDDFECNALIDRNITMVLMMVDQGYDRAPDLKRDDFWDEEVEPLYSEETAKIPNNPLKG
SVSDVKLPEYVHEIKMVPHCDDASPLVPGDEMRRRRVSVVPVKPSDQQHHHHGHRTRTSL
GNIEMFRSFKNKIERSFSKPHLHDDLGRKTFSHGMLENMEFEGSNTNIADGSHANNNSFT
NSAFVNSGEDLSNKRIDTSSSQPQLATGKRGSEHPFQHHVLDDVLEDDESDENQLTIRKK
SSVLQPAITLVERFNEATGQLETEVKRDEKKKKEEELREEGDNGKEEKDNKEDKKEEQDR
PSRPTRPFFIGVVRSESEDHSHPHLRPPTKFE
NT seq 1899 nt   +upstreamnt  +downstreamnt
atgacaataaactacaacttagcagtatccacttcaaaaccgtggacactgttcaagttg
ctgctcaaatggcgtggaagtatttggaaggcagtgatattggaattggcagtttggtta
gtattatatggcatactaagtgtcatttatcgaactgcactcaatcctgggcagcagaga
acattcgagcgaatagtacagtattgcgatagtcgattatcatatattccattgaatttt
atgttgggtttctttgttactgcagttgtcaacagatggacatatttgtatcaaattatt
ggatttattgataatattggtttaatggcagccgaatatgtccgtggacgtactgagcaa
gctcgaatgtatcgtcgaaatatcgttcgatactgtgaattggctcaagttctagtattc
cgtgacatcagtatgcgtactcgacgtcgatttccaactttggatacagtagtcgctgct
ggatttatgatgcctcacgagaaagatcgatttgatgagattcaatacaaatattcgaaa
tactgggttccatttcaatgggcatttagtttgacatatgaagcacgaaagaagggatta
attgaaagtgattattatcaagttgtcgtgcaggatgaaatcaaaaagttccgaacgggt
cttgcctggatttgtaattatgattgggtgccaattccaattatgtatccacaattagtc
tgtctggctgttcacacatactttttggtatgtcttttggcaagacaatatgtggtttca
gaacatgcagataataaaacagagattgatttatatttcccaatcatgtcaactctccag
tttattttctacatgggatggatgaaagttgccgaagcgatgcttaacccattcggagaa
gatgatgatgatttcgaatgcaatgctcttattgatcgaaatattacaatggtcttgatg
atggtagatcaaggatacgatagagctccagatcttaagagagatgacttctgggatgaa
gaagttgaaccattgtattctgaagaaactgcaaagataccaaataatccattgaagggt
tcagtgtcagatgtcaaacttccggaatacgtccatgaaatcaaaatggttccacattgt
gatgatgcttctccattagttccgggagatgagatgaggagaagacgagtttcagttgtt
ccagtcaagccatcggaccaacaacaccatcatcatggccatcgcacccgtacttcattg
ggtaacatcgaaatgttcagaagtttcaagaacaaaatcgagaggtcattctcgaaaccc
catttacacgacgacctaggtcgaaagacgttctcacatggaatgcttgaaaacatggaa
tttgagggatcaaatacaaatattgcagatggatcccatgcaaataacaattcattcaca
aattcagcatttgtgaattcaggagaagacctttcaaataagcgaattgacacatcatcc
agtcagccacaactggcaactgggaaacgtggaagtgaacatccattccaacatcacgta
cttgacgacgtcttagaagacgatgaatcagatgagaatcagttaacgattcggaagaaa
tcctctgttttgcaaccagcaattacattggttgaaagatttaatgaagctactggtcag
ttagaaactgaagtaaaaagagatgagaagaagaaaaaagaagaggaattgagagaagaa
ggagacaatggaaaagaagaaaaagataataaagaggataaaaaagaagaacaagatcgt
ccatcccgaccaactcgaccattcttcattggagtagtccgctcagaatctgaagatcat
agccatccgcaccttcgaccgccaacaaaatttgaatag

DBGET integrated database retrieval system