KEGG   Caenorhabditis elegans (nematode): CELE_ZK688.6Help
Entry
CELE_ZK688.6      CDS       T00019                                 

Gene name
pcp-5
Definition
(RefSeq) Prolyl carboxy peptidase like protein 5
  KO
K01285  lysosomal Pro-X carboxypeptidase [EC:3.4.16.2]
Organism
cel  Caenorhabditis elegans (nematode)
Brite
KEGG Orthology (KO) [BR:cel00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:cel01002]
    CELE_ZK688.6 (pcp-5)
Enzymes [BR:cel01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.2  lysosomal Pro-Xaa carboxypeptidase
     CELE_ZK688.6 (pcp-5)
Peptidases and inhibitors [BR:cel01002]
 Serine peptidases
  Family S28
   CELE_ZK688.6 (pcp-5)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S28 Abhydrolase_1 Peptidase_S9 Hydrolase_4 Peptidase_S37
Motif
Other DBs
NCBI-GeneID: 176111
NCBI-ProteinID: NP_498718
WormBase: WBGene00022801
Ensembl: WBGene00022801
UniProt: P34676
Position
III:complement(join(7905003..7905327,7905370..7905752,7905845..7906018,7906065..7906134,7906179..7906282,7906331..7906427,7906948..7907127,7907174..7907364,7907490..7907595,7907767..7907843))
Genome map
AA seq 568 aa AA seqDB search
MSKNPVQEGFSGYHCLFFTKRKPSKLCWALGKPINKGSSSNCHFIDRFHSFNPLYCIEKH
KMNIFISLAILIATTHCLTLLRDPVTQNGASKFEKSIGKYKYEEGYLKAPIDPFAFTNDL
EFDLRYFLNIDHYETGGPILFYTGNEGSLEAFAENTGFMWDLAPELKAAVVFVEHRFYGK
SQPFKNESYTDIRHLGYLSSQQALADFALSVQFFKNEKIKGAQKSAVIAFGGSYGGMLSA
WFRIKYPHIVDGAIAASAPVFWFTDSNIPEDVYDFIVTRAFLDAGCNRKAIEKGWIALDE
LAKSDSGRQYLNVLYKLDPKSKLENKDDIGFLKQYIRESMEAMAMVNYPYPTSFLSSLPA
WPVKEACKSASQPGKTQEESAEQLYKIVNLYYNYTGDKSTHCANAAKCDSAYGSLGDPLG
WPFQTCTEMVMPLCGSGYPNDFFWKDCPFTSEKYAEFCMQTFSSIHYNKTLLRPLAGGLA
FGATSLPSASNIVFSNGYLDPWSGGGYDHSDKVQGSVISVILKQGAHHYDLRGAHPQDTE
EVKKVRAMETQAIKKWIKEKARNSWRYD
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaagaatccagttcaagaaggtttttcaggttatcattgcctttttttcacgaaa
cgaaagccatcaaagctgtgttgggctctgggaaaaccaattaataaagggtcatcgagc
aactgtcactttatcgatcgatttcattcgtttaatcctctatattgtatagaaaaacac
aagatgaacattttcatctccttggcaattttaattgccacaacgcattgtctcacttta
ctacgagatcctgtcactcaaaatggtgcttcaaaatttgaaaaaagtattggaaaatac
aaatatgaagaaggatatctcaaagctccaattgatcctttcgcattcaccaatgatctt
gaatttgatttacgatatttcttgaatatcgatcattacgagactggtggtccaatactc
ttttacactggtaacgagggaagtcttgaggcatttgccgaaaacacaggattcatgtgg
gatcttgcaccagagctcaaggctgctgttgtttttgttgagcaccgattctacggaaaa
tctcaacctttcaaaaacgaaagctacacagacattcgtcatcttggttatctttcatcc
caacaggctctggctgattttgccctttctgtgcaattcttcaaaaatgagaaaatcaaa
ggagctcaaaagtcggcagttattgcatttggaggatcatacggtggaatgttgtcagct
tggtttagaatcaagtatccccatatagttgatggagcaattgccgcgtcagctccagta
ttttggttcacagactccaatattccagaagatgtttatgattttattgtcactcgggct
tttcttgatgctggatgcaacagaaaagctattgaaaaaggatggattgcattggatgaa
ttggcaaaaagtgacagtggaagacagtatttgaatgttctgtataaattagatcctaag
tcaaagttggaaaataaagatgatataggatttttgaagcaatacataagagaatcgatg
gaagcaatggctatggtaaactatccatatccaacttctttcctgagctctcttcctgcc
tggccagtcaaggaagcctgcaaatctgcaagtcaaccaggaaaaacacaagaagaatct
gcagaacaactgtacaaaattgtcaacctgtactacaattacacaggagacaagtcaacg
cattgtgcaaatgcagcgaaatgtgatagtgcatatggatcattaggtgatccattggga
tggccatttcaaacatgtacggaaatggttatgccactgtgtggaagtggatatccaaat
gatttcttctggaaggattgtccatttacatcagagaaatatgcagagttctgcatgcaa
acgttctcctcgatccattacaacaaaactcttcttcgcccattagccggtggccttgca
tttggagcaacttctcttccatctgcatccaatattgtcttctcgaatggttacctggat
ccatggagtggtggtggctacgatcattccgataaggtacagggatcagtgattagtgta
attctgaaacaaggagctcatcattatgatttacgtggagctcatccacaggataccgaa
gaagttaaaaaggttcgagccatggagacgcaggcaatcaagaaatggatcaaggagaag
gcgagaaattcttggagatatgattaa

DBGET integrated database retrieval system