KEGG   Caenorhabditis elegans (nematode): CELE_ZK795.4Help
Entry
CELE_ZK795.4      CDS       T00019                                 

Gene name
snb-7
Definition
(RefSeq) SyNaptoBrevin related
  KO
K08514  vesicle-associated membrane protein 5
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04130  SNARE interactions in vesicular transport
Brite
KEGG Orthology (KO) [BR:cel00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    CELE_ZK795.4 (snb-7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cel04131]
    CELE_ZK795.4 (snb-7)
Membrane trafficking [BR:cel04131]
 SNARE
  VAMP, Ykt6, Sec22 (R)
   VAMP
    CELE_ZK795.4 (snb-7)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Synaptobrevin Spc7 COG2 DUF533
Motif
Other DBs
NCBI-GeneID: 3565852
NCBI-ProteinID: NP_001023622
WormBase: WBGene00014084
Ensembl: WBGene00014084
UniProt: G5EBK2
Position
IV:12560868..12561176
Genome map
AA seq 102 aa AA seqDB search
MNHQPPPVSRVGWDDQKIMRTRRELDSVKAIMKENVQKIMERQGKLDDLVERAQRLEEAS
DVYVKCAVKIKREMSWKANSLRYGIIAVSSVSAFAGLAYSFL
NT seq 309 nt NT seq  +upstreamnt  +downstreamnt
atgaatcatcaaccaccaccagtgagccgtgtcggttgggacgatcaaaagattatgaga
acaagaagagaattggattcggtgaaggccattatgaaggagaatgtgcaaaaaatcatg
gagagacagggaaaacttgatgatcttgttgaaagagctcagaggctcgaggaggcatcg
gatgtgtacgtcaaatgcgccgtcaagataaaacgagagatgagctggaaggccaattct
cttcgctacgggatcattgctgtgtcaagtgtctccgcatttgcaggacttgcctattcg
ttcctataa

DBGET integrated database retrieval system