KEGG   Caenorhabditis elegans (nematode): CELE_ZK849.5
Entry
CELE_ZK849.5      CDS       T00019                                 

Gene name
best-26
Definition
(RefSeq) Bestrophin homolog 26
  KO
K22204  bestrophin, other
Organism
cel  Caenorhabditis elegans (nematode)
Brite
KEGG Orthology (KO) [BR:cel00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cel02000]
    CELE_ZK849.5 (best-26)
Transporters [BR:cel02000]
 Other transporters
  Pores ion channels [TC:1]
   CELE_ZK849.5 (best-26)
SSDB
Motif
Pfam: Bestrophin
Other DBs
NCBI-GeneID: 173291
NCBI-ProteinID: NP_493478
WormBase: WBGene00014103
Ensembl: WBGene00014103
UniProt: O18304
Position
I:join(14200221..14200280,14200342..14200466,14200515..14200652,14202489..14202664,14202713..14202819,14202866..14203069,14204121..14204270,14204316..14204464,14204517..14204643)
AA seq 411 aa
MTVPYYRDVPTGNALRNFFKIMLKRKGNLFTAIFKELCLFLGLYFLFMVIYRLVLPKSGG
QREIRKIVENLLSHQEFTIPLEFLLGFFVSSVVDRWRKSLDSLAYIESCAHAVVIGFPPN
SNGSDKNLLIRRTIIRYLVVSQILLYREISLKVRRRFKKLTILGKAKLLNQNEIDKLNKL
ECKHYDIYFLPISWALSLIEDKIDKENLANEFTILWGQIKEWQTKLSLLRNCDYIPIPLA
YPQAVFLAVRCYFAVCVFTRQHLDRYDSKMHTWITFFPVLTTFQYIFMMGWMKVAEILLN
PMGEDEDDFELNFIIDNNLKNGLDIVSGLCGNHRKLAEHEIENDCRPYYQTNEQDRKKNR
APPESLKNVEFKSFTMEKASKDSPMVVKSESVCCLRRRFNSSAKKHHDSKV
NT seq 1236 nt   +upstreamnt  +downstreamnt
atgactgttccatattatcgagatgttccaactggaaatgctctacgcaattttttcaaa
attatgctcaaaaggaaaggaaatttatttacagcgatttttaaagagttatgtttgttt
cttggcttgtattttttatttatggtgatctatcgacttgttttaccaaagagcggaggt
caacgtgaaatcagaaaaattgtcgaaaacttgctgtcccatcaggaatttacgataccc
ttggagtttttgcttggtttcttcgtttctagtgtggtggatcggtggagaaagtcgctg
gacagtttagcatatattgagagttgtgcccacgccgttgtcataggttttccacccaat
tccaatggctccgacaaaaacttactgatccgccgtacgatcatcagatacctagtggtc
tcccagatcttgttgtaccgtgagatctcgctgaaagtgaggaggagattcaagaagttg
acgatactgggaaaagctaaacttctgaatcagaatgagattgataaactgaataagttg
gagtgtaagcactatgacatctactttctgccaatcagttgggctctttcccttatcgag
gacaaaattgataaagagaatctggcgaacgagttcacaatcctgtggggtcaaatcaag
gagtggcagacaaagctctcacttttgcggaactgcgactacatcccgattccgttggcg
tacccgcaggctgtgttcctagccgttcgttgttactttgcagtgtgtgtgttcacaaga
cagcacttggatagatatgattcgaagatgcacacctggataactttcttcccagtgctc
acaacattccaatacattttcatgatgggctggatgaaggtcgccgaaatcctgctcaac
ccaatgggagaagacgaagacgattttgagctgaactttatcattgataacaatcttaaa
aatggattggatattgtgagtggattatgtggaaaccataggaaacttgcagaacatgaa
attgaaaatgattgtcgtccatattatcaaaccaatgaacaagatcgtaaaaagaatcgt
gcaccgccggaatccttgaagaacgtggagttcaaatcattcacaatggaaaaggcttct
aaggactcgccaatggttgtgaaatcggaatctgtttgttgcctacgccggagattcaat
agcagtgcaaaaaagcaccatgattcaaaagtctag

DBGET integrated database retrieval system