KEGG   Caenorhabditis elegans (nematode): CELE_ZK938.5
Entry
CELE_ZK938.5      CDS       T00019                                 

Symbol
old-2
Name
(RefSeq) Protein kinase domain-containing protein
Organism
cel  Caenorhabditis elegans (nematode)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Haspin_kinase
Other DBs
NCBI-GeneID: 191738
NCBI-ProteinID: NP_496123
WormBase: WBGene00003863
Ensembl: WBGene00003863
UniProt: Q23677
Position
II:complement(join(9847483..9847578,9847633..9847738,9847786..9848034,9848111..9848220,9848269..9848452,9848504..9848627,9848678..9849042,9849286..9849483,9849533..9849597))
AA seq 498 aa
MTGSVIFFALFSSYCFASCYARNLTLGRNFEDSFKRVPRASEKNELGDSNVQQIIFISLY
SVFVALAIGICCLIKAYKSKKRQLPANRSKGNEYLLEPTTADQKKRYSNNIVPPEPTPYP
ITSGEDDFGKTPSRLSNEECPPELKLAPINDRIKYLHYYAEVEINEEDLDISKGRPLGSG
EFGIIRKGFLRSKNSKNKETESRLEVAVKSPLNEYNHIQQELIYDELKVMCAVGKHPNIL
ALVGGITIGEKRMIISELVENGDLLSFLRKNRRNFTIDQLAFEPEKPSLGLVDLVSFAFQ
IAKGMEYLIHVPCVHRDLALRNVLIKGNMVIRIADFGLARRHKNKDYYKTQSVDTPLPIH
WMAPESIDKLLFTQKSDVWSYGVCLYELFSLGKSPYKNVIKYDERDSYCKYVLAYLNEGK
RLAQPAHADAEIYNVMKLCWDLDMNSRTTFLDCIEFFEKELKTTSNEYFLDLTRKLRSET
NNQLRLSNWLSDEKHCDS
NT seq 1497 nt   +upstreamnt  +downstreamnt
atgacgggttctgtaattttttttgctttattttcttcatattgctttgcttcatgctac
gcacgaaatttaacattgggtagaaactttgaagattcgttcaaaagagtcccgcgagcg
tctgaaaagaatgaattgggcgattcaaatgtacaacagattatattcatttcgttatac
agtgtgtttgttgcacttgcaattggaatttgctgtttgattaaagcttacaaatcaaag
aaacgacagctcccggcaaacagatcaaaaggcaatgagtatcttcttgagccaacaacg
gcggatcagaagaaaagatattcaaacaatatagttccaccagaaccaacgccttatcca
attacttccggggaagatgattttgggaaaactccttctcgtttgtcaaatgaagaatgc
cctccagaactaaaactggctccaattaatgacagaatcaagtaccttcattattacgcg
gaagttgaaatcaatgaggaagatcttgatatttcaaagggaagaccgctaggatcagga
gagtttggaataatacgaaaaggatttttgagaagcaaaaattccaaaaataaggaaaca
gaaagcaggttggaagtggcagtgaaatcaccgttaaatgaatacaatcatattcaacaa
gaattgatatatgatgaactgaaagtgatgtgtgcagtcggtaaacacccaaacatttta
gccttagtcggaggaattacaattggagaaaagaggatgatcatatccgagcttgtggag
aacggagacctactaagtttcttgagaaaaaatcggcgaaatttcacaattgatcaattg
gcttttgaacctgaaaaaccgtcattgggccttgttgatttagtctcatttgcattccaa
attgcaaaagggatggagtatttgattcacgttccgtgcgttcatagagacttggctctc
cgcaatgtgctaataaagggaaatatggtaattcgaattgcagactttggattggctagg
agacataaaaataaagattattacaaaactcaaagtgtcgatacaccgcttccaatacac
tggatggcacctgaaagtatagacaaattactgttcactcagaaatcagatgtttggtca
tatggggtctgtctttatgaactattttctttgggaaaatcaccttataaaaatgtgata
aaatatgatgaaagagattcctattgcaaatatgtgctggcttacttgaatgaaggaaaa
cgacttgcacagcctgcacatgctgatgctgaaatatataatgtaatgaaactatgctgg
gatctagatatgaatagtcgtacaacattcttagactgcattgagttttttgagaaagaa
ttgaaaacaacatcaaatgagtattttcttgatctcaccagaaagctccgttcagaaacc
aacaatcaacttcgacttagtaattggctttctgatgagaaacattgtgatagttaa

DBGET integrated database retrieval system