KEGG   Caenorhabditis elegans (nematode): CELE_R04F11.3Help
Entry
CELE_R04F11.3     CDS       T00019                                 

Gene name
R04F11.3
Definition
(RefSeq) Uncharacterized protein
  KO
K03504  DNA polymerase delta subunit 3
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel00230  Purine metabolism
cel00240  Pyrimidine metabolism
cel01100  Metabolic pathways
cel03030  DNA replication
cel03410  Base excision repair
cel03420  Nucleotide excision repair
cel03430  Mismatch repair
cel03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:cel00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    CELE_R04F11.3 (R04F11.3)
   00240 Pyrimidine metabolism
    CELE_R04F11.3 (R04F11.3)
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    CELE_R04F11.3 (R04F11.3)
   03410 Base excision repair
    CELE_R04F11.3 (R04F11.3)
   03420 Nucleotide excision repair
    CELE_R04F11.3 (R04F11.3)
   03430 Mismatch repair
    CELE_R04F11.3 (R04F11.3)
   03440 Homologous recombination
    CELE_R04F11.3 (R04F11.3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:cel01009]
    CELE_R04F11.3 (R04F11.3)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:cel03032]
    CELE_R04F11.3 (R04F11.3)
   03400 DNA repair and recombination proteins [BR:cel03400]
    CELE_R04F11.3 (R04F11.3)
Protein phosphatases and associated proteins [BR:cel01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CELE_R04F11.3 (R04F11.3)
DNA replication proteins [BR:cel03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   DNA polymerase delta complex
    CELE_R04F11.3 (R04F11.3)
DNA repair and recombination proteins [BR:cel03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      CELE_R04F11.3 (R04F11.3)
   MMR (mismatch exicision repair)
    DNA polymerase delta complex
     CELE_R04F11.3 (R04F11.3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CDC27 SPC25
Motif
Other DBs
NCBI-GeneID: 179688
NCBI-ProteinID: NP_506088
WormBase: WBGene00011016
Ensembl: WBGene00011016
UniProt: Q21730
Position
V:complement(join(12315125..12315276,12316127..12317031,12317080..12317180))
Genome map
AA seq 385 aa AA seqDB search
MVENFTSILDDVCDPLTLTNFIKQTSLPRSEATSILEDYVKSKGDPLWALYEISGAVDSS
EFTFLPAEAQIIKHVVVPESDLTDTKSKFSEVFSTCLHSIQRTNPKDTRVYGRSWADNDD
LKGKKLPEQLKPQKKSDSSNVKVEKEKSTEQKPTIEPSTSSKSAIETKKSSIAPPKKQGT
LSMFSKKTEKKTEKTEKSQSPVPQDQEKKNRKRPMIEVDESEELIKATKPKEKTPEKKPE
KLIISQDSDEFPSSREQSVEKEKSPPAKRKRVNDENKKAKKRLIVPDSDDEEQVPMEVEE
KKTETKTNSSLPEDRRRTTRIEKVVETYVDEDGYLVSKAVQKAVECSPQKASPEKPKPKV
ITAPAPGTKKAPKKNSMITSFFKKT
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atggtggagaatttcacctcaatactcgatgatgtgtgcgaccctctgacactcacaaat
ttcataaagcagacatcactaccaaggtcagaagccacaagcatccttgaagattatgtg
aaatcaaaaggggatccgctatgggcactttatgaaatcagtggagctgttgattcgtct
gaatttaccttccttcctgctgaagctcaaatcataaaacacgttgttgttcctgaatcg
gatttgactgacacaaaatcaaagttttctgaggttttttcgacatgcttgcacagtatt
caacgtactaatccaaaagatacgcgtgtatatggacgttcatgggctgataatgatgac
ttgaaaggtaaaaaattgccagaacaattgaagccacaaaagaaatcggattcgtcaaat
gttaaagttgagaaagaaaaaagtactgagcaaaaaccaacaatcgaaccaagtacatcc
tcgaagtcagctattgagacgaagaaaagttccattgctccaccgaaaaaacaaggaact
ctgagtatgttttccaaaaaaactgaaaagaaaactgaaaagactgagaaatctcaatcc
cctgttcctcaagatcaagaaaagaaaaatcgtaaacgtcccatgatagaagtcgatgag
tctgaagaacttattaaggccactaaaccaaaagaaaagacaccagagaaaaaaccggaa
aaattgattatttctcaagacagtgatgaatttccatcatcaagagagcaaagtgtggag
aaggaaaagtcaccaccagcaaagcgaaaaagggttaatgatgagaacaagaaagcgaag
aagagacttattgtaccggattctgacgatgaagagcaagttccaatggaggtcgaagaa
aagaaaacggaaacaaaaacaaactcatctttgccagaagatagacggagaaccacacga
atcgaaaaggttgtcgagacatatgttgatgaagatggttatttggtatccaaggcagtt
caaaaggctgtagaatgttctccacaaaaagcatcacccgaaaagcccaaaccgaaagtg
ataactgctccagcacctggtacaaaaaaggcacccaaaaagaactcgatgatcacctcg
tttttcaagaaaacttag

DBGET integrated database retrieval system