KEGG   Caenorhabditis elegans (nematode): CELE_T21C9.6
Entry
CELE_T21C9.6      CDS       T00019                                 
Symbol
T21C9.6
Name
(RefSeq) Uncharacterized protein
Organism
cel  Caenorhabditis elegans (nematode)
SSDB
Motif
Pfam: PPDK_N PEP-utilizers
Other DBs
NCBI-GeneID: 179478
NCBI-ProteinID: NP_001369933
WormBase: WBGene00011893
Ensembl: WBGene00011893
Position
V:10581887..10587077
AA seq 1235 aa
MLIFLFLLFLSAPLCKFVLYPVIYAFLKWRHPVKKFTAPTAKIRDIINPDKEEWELEHIK
NEEILTISGSGEDNSFVYIQVITKNEIHFAHIRVFEKGILYSGSYKAVFSDNRTISCGPL
LIELRNPFRKWRINFRGYLNDAKGNSHFVILSGWWKCVSNARFFYSNALLKSFNEIYNDK
PTALIENLKTIEKYRKGNVLNQMGEYHAEIKIGKDEVVEHRYRGLRHRNPLDLETSSTHF
HTYLSDANAISYRVNSVDEKKSVSHGVGFRSDHSARPIIIDNSHSLESDNMLPVQFKYVS
RGLLPLEMRKGRKLCHFTFIREDNKVVDVTALEVNSAIFTGVGFVVRVREAIHEVTTKLP
DSFPEYHATESEKMKSVVSFNHRACQDKMLTGGKGANLARLQAITDDFHVPPGIVVTTAA
FNKHVIANPNVLEEIKLLDINDKNAEYYEDVGKRIEGLLFESEVSQELQKEIKEWLPRSE
YYAVRSSAVGEDGADLSSAGQLESYLDVIEIDIVDKLKLCWGSNFRREVLNYRKNYGQQL
NPSMAVVIQEMDRNGVAGVMFTANPVKLDRGEIVINALKGSGEQIVSGVTTPDEIYVNRI
HKTVVINKVGVDCCLDDYQIEKLTKVGEYLERIFGKPQDIEFVVRNQMVNIVQSRDITGL
DKETQFEMCTEYNSPSIHDKEILTNANVGEVLPVPVNAMEAHNLTGMFDKVIASMTFQEL
NDVVPAHTSIGFSVAHRKIFFNLGEVVLRIWELVEKDRITDIVIAGETLFNAEMFQQAAH
QYGKVSPFFPLKRMFNMIKLIYFTSNSVKAKIVKIDEEAKKLVPNDKMTIEIVFKKYDEL
EKLWCDASHCHTSLSMFSSFTYVLCGMLIRGSDNGPLSNDNISDFANVFSNNSRGDVISA
DVPNSLKKLAKTIREESIDKEFCAAEDDEALKTLENGKKSSDELRRFLELHGHRGPKELY
LDATTWEEDTNLLVHTIKSMLACPETSGKTIENEDDIIDNLKCKPTGIRRRLLKYFIGQT
HRGVSFRETAKNHLVSTTHSLRKACRMVGKKLYEKGYLPDPNLWMHFSMDELKELNATRS
AKLVSRAIRRKQISSKFEGLQFPLVSHGYMNPIKIEIAETDANIGIILRGTTVCEGKVRA
RARVAKTLEEAKETKPGEILITKYTDICWSPFFPIISGIVTEIGGLLSHGAVVAREYGLP
SLIAVSNATYHFKTGDLVELDSISGTISRLDTNQE
NT seq 3708 nt   +upstreamnt  +downstreamnt
atgttgatattcctgtttttgctgtttctttcagctccactatgcaagtttgtattgtat
ccagtgatatacgcgttccttaaatggagacatccggtcaaaaagttcactgctccaact
gcaaagattcgtgacattataaaccctgataaagaggaatgggaactggaacatattaaa
aatgaagaaattctaacaattagcggttctggagaagataatagttttgtgtatattcaa
gttataacaaagaatgaaattcattttgctcatattcgagttttcgaaaaaggaattctt
tattccggatcatacaaagcagtattctccgataatcgaacaatttcatgtggaccattg
ctaattgagcttcgaaacccattccgtaaatggagaattaatttccgtggatacctgaat
gatgctaaaggcaactctcattttgttatactttcgggatggtggaaatgtgtgtcgaat
gctagatttttctattcaaatgctcttttgaagtcattcaatgaaatttacaatgacaaa
ccaactgcactgattgagaatttgaaaactatcgaaaagtaccgaaaaggaaatgtgtta
aaccaaatgggtgaatatcacgcagaaatcaaaattgggaaagatgaagttgtcgaacat
agatatagaggacttcgtcatagaaatccattagacttggagacaagttctacacatttt
catacatacctgagcgatgcaaatgcaatttcctatcgtgtcaactctgtagatgaaaag
aaatcagttagtcacggagtgggattccgttcagatcacagtgctcgtccaataattatt
gataattctcattcccttgagtcagataatatgcttccagttcaattcaaatatgtttca
cgtggacttctccctcttgaaatgagaaaaggacgaaaattatgtcatttcacgtttatt
cgagaagacaacaaggttgtcgacgttactgcgttagaagttaattctgcaatttttacg
ggagttggatttgtggttagagtgagagaggcaattcatgaagttacaactaaacttccc
gatagtttcccggaatatcatgcaactgaatcagaaaagatgaaatcagtagtctcattc
aatcacagagcatgtcaggataaaatgttaactggcggaaaaggtgcgaatttagcaaga
cttcaagcaatcaccgatgatttccatgtgcctcctggaatagttgtcactaccgcagct
ttcaacaagcatgtaattgcgaatccaaatgttttagaagaaataaaacttctcgatatc
aacgataaaaatgccgagtattatgaggatgttggtaaaagaattgaagggcttcttttc
gaaagtgaagtgtctcaagaactgcaaaaagaaattaaggagtggttaccgcgttctgaa
tactatgcagtaagatcatctgcagttggagaagatggagcagatctttcatcagctgga
caactggaaagttacttggatgtgattgaaattgatatagttgataaactgaagctgtgt
tggggctctaattttagaagagaagtattgaattacagaaaaaactacggtcagcagctt
aatccgtcaatggctgtagttattcaagaaatggatcgaaacggagtggctggagttatg
ttcaccgcaaatccagtaaaattagatcgtggagaaattgtgataaatgcattgaaagga
agtggggaacaaattgtgagcggtgtgacgacaccagatgagatttacgtaaatcgaatc
cataaaacggtggtcataaataaagttggcgtcgattgttgcttggatgactatcagatt
gagaaacttaccaaagttggagagtacttggagagaatatttggaaaacctcaagatatt
gaatttgttgttagaaatcaaatggttaatattgttcaaagtcgagatattactggtttg
gataaggagactcaatttgaaatgtgcacagaatataattcgccaagtattcatgacaaa
gaaattctaacaaatgcaaatgttggagaagttcttccagttccggttaatgccatggaa
gctcataatttaactggaatgtttgataaagtcattgcatcaatgacatttcaagagctc
aatgatgttgtgccggcacatacttcaatcggcttttccgttgcacaccgtaaaatattt
ttcaatttgggagaagttgttcttcgaatttgggaactggttgaaaaagatcgaattact
gatatagtgattgctggagaaactcttttcaatgcggaaatgttccaacaagcagctcat
caatacggaaaagtttcacctttctttccgttgaagagaatgttcaacatgatcaagtta
atatattttacatcaaacagtgtgaaggcgaaaattgtcaaaatcgacgaggaagcaaag
aaactggtgccaaatgataaaatgacgattgagatagtattcaaaaaatatgacgagctt
gagaagttgtggtgtgatgcaagccattgtcacaccagtctttcaatgttctcttctttc
acatatgtgctatgtggaatgcttattcgtggaagtgacaatggacctctttccaatgac
aatatatccgattttgccaatgtgttctccaataactctcgtggagatgtaatcagtgct
gacgttccaaattctttaaagaaacttgcaaaaaccattcgagaagagagtattgataaa
gaattttgtgctgcagaagacgatgaggctttgaaaacacttgaaaacggaaagaaaagc
tctgacgaattgagaagatttctagaattgcatggacatcgagggccgaaagaactttat
ttagatgctaccacctgggaagaggacaccaatttattagttcatacaattaaaagtatg
ttggcttgcccagaaacgtctgggaagactattgagaatgaagatgatattattgataac
ttgaaatgcaagccgactggtattagaagaagacttttgaaatatttcatcggtcagaca
caccgtggagtttcatttagagaaacagcaaaaaatcatttagtttccacgacacattct
cttcgaaaggcatgcagaatggttggaaagaagttgtatgaaaaaggatatcttcctgat
ccaaatctttggatgcacttctcaatggacgaacttaaagaattgaatgcaacaagaagt
gcaaaacttgtttccagagcaatcagaagaaaacagatttcatcgaagtttgaaggtctc
caatttccacttgtttctcatggatacatgaatccaattaaaatagaaatcgctgaaact
gatgcaaatattggtatcattcttcgaggaactacagtatgcgaaggaaaagttagagcc
agagcaagagttgccaaaacattggaagaagcaaaagagacaaaaccaggagagattctc
attacaaaatacacggatatctgttggtctccatttttcccaattatcagtggaattgtc
accgagattggaggactactcagtcatggggctgttgttgcaagagagtatggactacca
agtttgattgcagtttccaatgcaacatatcactttaaaactggtgatcttgttgaactg
gactctatttctggcacaattagccgactggacactaatcaggaataa

DBGET integrated database retrieval system