KEGG   Caenorhabditis elegans (nematode): CELE_R13H8.1Help
Entry
CELE_R13H8.1      CDS       T00019                                 

Gene name
daf-16
Definition
(RefSeq) Forkhead box protein O
  KO
K09408  forkhead box protein O3
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04068  FoxO signaling pathway
cel04137  Mitophagy - animal
cel04212  Longevity regulating pathway - worm
cel04213  Longevity regulating pathway - multiple species
Module
cel_M00676  PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:cel00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    CELE_R13H8.1 (daf-16)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    CELE_R13H8.1 (daf-16)
 09150 Organismal Systems
  09149 Aging
   04212 Longevity regulating pathway - worm
    CELE_R13H8.1 (daf-16)
   04213 Longevity regulating pathway - multiple species
    CELE_R13H8.1 (daf-16)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cel03000]
    CELE_R13H8.1 (daf-16)
Transcription factors [BR:cel03000]
 Eukaryotic Type
  Helix-turn-helix
   Fork head/winged helix other regulators
    CELE_R13H8.1 (daf-16)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Forkhead Peptidase_C7
Motif
Other DBs
NCBI-GeneID: 172981
NCBI-ProteinID: NP_001251490
WormBase: WBGene00000912
Ensembl: WBGene00000912
UniProt: O16850
Position
I:join(10750498..10750509,10750572..10750655,10750894..10750984,10751038..10751188,10763590..10763706,10764351..10764496,10765210..10765283,10772960..10773121,10773284..10773465,10773525..10773744,10773994..10774106,10774777..10775050)
Genome map
AA seq 541 aa AA seqDB search
MQLEQKSSLHCSKCRNFLQKFSQDMQAWNCRELDSPLPSDITLHNLEPARPDSGMSFSTD
FDDDFFNLDLHQQERSASFGGVTQYSQQFLREKCSFSPYFHTSLETVDSGRTSLYGSNEQ
CGQLGGASSNGSTAMLHTPDGSNSHQTSFPSDFRMSESPDDTVSGKKTTTRRNAWGNMSY
AELITTAIMASPEKRLTLAQVYEWMVQNVPYFRDKGDSNSSAGWKNSIRHNLSLHSRFMR
IQNEGAGKSSWWVINPDAKPGRNPRRTRERSNTIETTTKAQLEKSRRGAKKRIKERALMG
SLHSTLNGNSIAGSIQTISHDLYDDDSMQGAFDNVPSSFRPRTQSNLSIPGSSSRVSPAI
GSDIYDDLEFPSWVGESVPAIPSDIVDRTDQMRIDATTHIGGVQIKQESKPIKTEPIAPP
PSYHELNSVRGSCAQNPLLRNPIVPSTNFKPMPLPGAYGNYQNGGITPINWLSTSNSSPL
PGIQSCGIVAAQHTVASSSALPIDLENLTLPDQPLMDTMDVDALIRHELSQAGGQHIHFD
L
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgcaactcgagcaaaagtcttcattacattgctcgaagtgccgaaattttctgcaaaaa
ttctcacaggacatgcaagcgtggaactgtcgtgagctcgattcgccgctaccatctgac
atcacactgcacaatctcgaaccggcaaggcctgattccggaatgagtttttccactgat
tttgacgatgatttcttcaatctcgacctccatcaacaagagcgttcggcttcttttggc
ggagtaacccagtattctcaacaatttcttcgcgaaaaatgctcgttctctccgtatttc
cacacatctttagagactgttgacagcggaagaactagcctatacgggagcaatgagcaa
tgtggacagctcggcggagcatcttcaaacgggtcgacagcaatgcttcatactccagat
ggaagcaattctcatcagacatcgtttccttcggatttcagaatgtccgaatcgccagac
gataccgtatcgggaaaaaagacaacgaccagacggaacgcttggggaaatatgtcatat
gctgaacttatcactacagccattatggctagtccagagaaacggttaactcttgcacaa
gtttacgaatggatggtccagaatgttccatacttcagggataagggagattcgaacagt
tcagctggatggaagaactcgatccgtcacaatctgtctcttcattctcgtttcatgcga
attcagaatgaaggagccggaaagagctcgtggtgggttattaatccagatgcaaagcca
ggaaggaatccacggcgtacacgtgaacgatccaatactattgagacgactacaaaggct
caactcgaaaaatctcgccgcggagccaagaagaggataaaggagagagcattgatgggc
tcccttcactcgacacttaatggaaattcgattgccggatcgattcaaacgatttctcac
gatttgtatgatgatgattcaatgcaaggagcatttgataacgttccatcatctttccgt
ccccgaactcaatcgaacctctcgattcctggatcgtcgtctcgtgtttctccagctatt
ggaagtgatatctatgatgatctagaattcccatcatgggttggcgaatcggttccagca
attccaagtgatattgttgatagaactgatcaaatgcgtatcgatgcaactactcatatt
ggtggagttcagattaagcaggagtcgaagccgattaagacggaaccaattgctccacca
ccatcataccacgagttgaacagtgtccgtggatcgtgtgctcagaatccacttcttcga
aatccaattgtgccaagcactaacttcaagccaatgccactaccgggtgcctatggaaac
tatcaaaatggtggaataactccaatcaattggctatcaacatccaactcatctccactg
cctggaattcaatcgtgtggaattgtagctgcacagcatactgtcgcttcttcatcggct
cttccaattgatttggaaaatctgacacttcccgatcagccactgatggatactatggat
gttgatgcattgatcagacatgagctgagtcaagctggagggcagcatattcattttgat
ttgtaa

DBGET integrated database retrieval system