KEGG   Caenorhabditis elegans (nematode): CELE_T09F3.3Help
Entry
CELE_T09F3.3      CDS       T00019                                 

Gene name
gpd-1
Definition
(RefSeq) Glyceraldehyde-3-phosphate dehydrogenase 1
  KO
K00134  glyceraldehyde 3-phosphate dehydrogenase [EC:1.2.1.12]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel00010  Glycolysis / Gluconeogenesis
cel01100  Metabolic pathways
cel01200  Carbon metabolism
cel01230  Biosynthesis of amino acids
Module
cel_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
cel_M00002  Glycolysis, core module involving three-carbon compounds
cel_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cel00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CELE_T09F3.3 (gpd-1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cel04131]
    CELE_T09F3.3 (gpd-1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cel04147]
    CELE_T09F3.3 (gpd-1)
Enzymes [BR:cel01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.12  glyceraldehyde-3-phosphate dehydrogenase (phosphorylating)
     CELE_T09F3.3 (gpd-1)
Membrane trafficking [BR:cel04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    CELE_T09F3.3 (gpd-1)
Exosome [BR:cel04147]
 Exosomal proteins
  Proteins found in most exosomes
   CELE_T09F3.3 (gpd-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gp_dh_C Gp_dh_N DapB_N 2-Hacid_dh_C Pept_tRNA_hydro
Motif
Other DBs
NCBI-GeneID: 174603
NCBI-ProteinID: NP_496237
WormBase: WBGene00001683
Ensembl: WBGene00001683
UniProt: P04970
Position
II:join(10394137..10394659,10394712..10395144,10395193..10395262)
Genome map
AA seq 341 aa AA seqDB search
MSKANVGINGFGRIGRLVLRAAVEKDTVQVVAVNDPFITIDYMVYLFKYDSTHGQFKGTV
TYDGDFLIVQKDGKSSHKIKVFNSKDPAAIAWGSVKADFVVESTGVFTTKEKASAHLQGG
AKKVIISAPSADAPMYVVGVNHEKYDASNDHVVSNASCTTNCLAPLAKVINDNFGIIEGL
MTTVHAVTATQKTVDGPSGKLWRDGRGAGQNIIPASTGAAKAVGKVIPELNGKLTGMAFR
VPTPDVSVVDLTVRLEKPASMDDIKKVVKAAADGPMKGILAYTEDQVVSTDFVSDPHSSI
FDAGACISLNPNFVKLVSWYDNEYGYSNRVVDLIGYIATRG
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaggccaacgtcggaatcaacggtttcggaagaatcggacgtctcgtgctccgc
gcggctgtcgaaaaggacacggttcaagtggtcgccgtcaacgatccgtttatcacaatc
gactacatggtctaccttttcaagtatgactcgacccacggtcaattcaaaggaactgtt
acctacgatggagactttctgattgtccagaaagatggcaaatcatcgcacaagatcaag
gtcttcaacagcaaggatccagctgccatcgcatggggatcagtcaaagccgatttcgtt
gtcgagtctactggagttttcacgacaaaggaaaaggcttctgctcatcttcaaggagga
gccaagaaggtcatcatctctgctccatctgctgatgctccaatgtacgtggttggagta
aaccatgagaagtacgacgcttcgaatgatcacgttgtttctaacgcatcgtgcaccacc
aactgtctggcaccactggcgaaggttatcaatgataacttcggtatcatcgaaggactc
atgacgacagtgcacgctgtaaccgcaacccagaagacagtcgatggaccatccggaaag
ctgtggagagatggacgcggtgctggacaaaacatcattccagcttccactggagccgcc
aaggctgtgggaaaagtcattccggagctgaacggaaaactcactggaatggctttccgt
gtccctacaccagatgtttccgtcgttgatctgaccgttcgcctcgagaagccagcttcg
atggacgacatcaagaaggtagtcaaggccgctgccgatggaccaatgaagggaatcctc
gcctacactgaagatcaagttgtgtcgactgatttcgtgtccgaccctcactcgtccatt
ttcgatgctggagcatgcatttcgctcaacccgaacttcgtcaagctcgtctcttggtac
gacaatgaatatggatactcgaaccgtgttgtcgacctcatcggatacatcgccacccgt
ggataa

DBGET integrated database retrieval system