KEGG   Cellvibrio sp. PSBB006: CBR65_07650Help
Entry
CBR65_07650       CDS       T04891                                 

Definition
(GenBank) cellobiohydrolase
  KO
K19668  cellulose 1,4-beta-cellobiosidase [EC:3.2.1.91]
Organism
cell  Cellvibrio sp. PSBB006
Pathway
cell00500  Starch and sucrose metabolism
cell01100  Metabolic pathways
cell02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cell00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CBR65_07650
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CBR65_07650
Enzymes [BR:cell01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.91  cellulose 1,4-beta-cellobiosidase (non-reducing end)
     CBR65_07650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_6 CBM_2 CBM_10 CBM49
Motif
Other DBs
NCBI-ProteinID: ARU27322
UniProt: A0A1Y0FV25
Position
1850557..1852647
Genome map
AA seq 696 aa AA seqDB search
MIRLTRKGYGLATMLSLGMAAATFGSAAQAATCTYSISNEWNTGYTGTISINNTDSSAIS
GWSVNWQYNTNRVTSSWNANLSGSNPYTATSLGWNGNIAPGQTVSFGFQVNKNGGSAETP
TVNGAVCSGGGVTSSSASSVASSTPTSSAPNSSSSTPTTGGQQCNWYGTLYPLCTSTQSG
WGWEQNRSCISASTCSSQPAPYGIVGGSSASSTPVSSSSSSVVVSSVPSSSAPSSSAPSS
SVPSSSVPSSSVPSSSVPSSSAPSSSAPSSSVASSTSSADWGNRMDNPFIGANWYINQDW
ADNATASGGAAIADVSTAVWMDRIGAIDPEDPNVLGLREHLDAALDQGANLIKVVIYDLP
NRDCHALASNGELLMAEDGFNRYVNEYIAPIVDIFSDPKYNSLRIVTIIEPDSLPNLVTN
ISTPKCQEAAGPGGYIDGTRHTLTELGKLPNVYSYIDIGHSGWLGWPDNFQEATTLIADA
IKGAEKGVNSVAGFVSNTAGYTPLREPFLDSLSTGGMPGNPGVQVRQAAFYEWNPYFSEI
SFVQAWRNRMIELGFPSTIGMLIDTSRNGWGGSDRPTAQSTSTSVDTFVDESRVDRRYHR
GNWCNQPGGIGERPTVAPEPGIDAYVWVKPPGESDGVAEAGIIDPVDPAKGFDRNCDPTF
TNSSGTLTGSLPGAPHAGRWHTEGFQLLLNNAYPPL
NT seq 2091 nt NT seq  +upstreamnt  +downstreamnt
atgataaggctaacaagaaagggctacggcctggcgaccatgctgagtctcggcatggcg
gcagcgacctttggctcggcagcccaggcggcaacctgtacctacagcatcagcaacgag
tggaacaccggctacaccggtacgatttccatcaacaataccgattccagtgcgatcagc
ggctggagtgtgaactggcaatacaacaccaaccgtgtgaccagctcctggaacgccaac
ctcagcggcagcaatccctacaccgcgacctctttgggctggaacggcaatatcgcaccg
ggacaaactgtgtcctttggtttccaggtcaataaaaacggtggctctgccgaaaccccg
accgtgaatggcgccgtctgttccggtggcggtgtgaccagttcttctgcgtccagcgtg
gccagcagcacgcctacgagcagcgctccgaattcatcttcaagcacgccgacaaccggc
ggccagcaatgtaactggtacggcaccttgtatcccttgtgtacctctacccaaagtggc
tggggctgggagcaaaatcgcagctgtatctccgcgagcacctgtagctcacaaccggcg
ccttatggcattgtcggtggttcttccgccagcagcacaccggtcagctcaagcagctca
agtgttgttgtgagcagcgtgccatcgtcgagtgcaccctcctcaagtgcgccttcttcc
agcgtgccatcttcaagcgttccttcctctagcgtgccctcctcaagtgtgccgtcttcc
agcgcgccctcgtcgagtgctccatcctccagcgtcgcctcttccaccagttcagctgac
tggggcaaccgtatggataaccccttcatcggcgccaactggtacatcaaccaggattgg
gctgataacgctactgcctccggcggtgccgctatcgctgacgtcagcaccgccgtatgg
atggaccgcatcggtgcaatcgatccggaagatcccaacgtactcggcctgcgcgaacat
ttggacgctgcattggaccaaggcgcgaacctgatcaaggttgtgatctatgacctgcca
aaccgcgactgtcacgcgctggcttccaacggtgaattgttgatggccgaagatggcttc
aaccgttacgtgaacgagtatattgcgccgattgtggatatcttctccgatccgaaatac
aacagcttgcgcattgtcaccatcattgagccggattcgctgccaaacctggtgactaac
atctctacccccaagtgtcaggaagctgctggtcccggcggttacatcgacggcacccgt
catacgctaaccgagctgggcaaactgccaaacgtttactcctacatcgacatcggccac
tctggctggttgggctggccggataacttccaggaagcgaccacccttatcgccgacgcc
atcaaaggtgctgagaaaggtgtaaacagtgttgccggtttcgtttccaacaccgctggt
tacacaccgctgcgcgagcccttccttgactccctgtctaccggcggcatgccgggcaat
ccaggcgtgcaagtacgtcaggcagccttctatgagtggaacccctacttcagcgaaatc
agctttgtgcaggcttggcgcaaccgcatgatcgagctgggtttcccgagcaccatcggc
atgctgatcgatacctcgcgcaacggctggggcggttctgatcgtccgaccgcgcaatcc
accagcaccagtgttgataccttcgtggacgagtcccgcgtagaccgtcgctatcaccgc
ggcaactggtgtaaccagcctggcggtatcggtgagcgtcctaccgttgctccggaacct
ggtatcgatgcttacgtgtgggtgaaaccaccaggtgagtcagacggtgtggccgaagcc
ggcatcatcgatcctgtcgacccggcgaaaggttttgaccgcaactgcgatccgaccttc
accaattccagcggcacattgaccggttcacttcccggtgcaccccatgcgggccgctgg
cacaccgaagggttccagcttctgttgaacaacgcataccccccgctgtaa

DBGET integrated database retrieval system