KEGG   Cellvibrio sp. PSBB006: CBR65_07840Help
Entry
CBR65_07840       CDS       T04891                                 

Definition
(GenBank) mannonate dehydratase
  KO
K01686  mannonate dehydratase [EC:4.2.1.8]
Organism
cell  Cellvibrio sp. PSBB006
Pathway
cell00040  Pentose and glucuronate interconversions
cell01100  Metabolic pathways
Module
cell_M00061  D-Glucuronate degradation, D-glucuronate => pyruvate + D-glyceraldehyde 3P
Brite
KEGG Orthology (KO) [BR:cell00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CBR65_07840
Enzymes [BR:cell01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.8  mannonate dehydratase
     CBR65_07840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UxuA AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: ARU27357
UniProt: A0A1Y0FVD5
Position
1901972..1903165
Genome map
AA seq 397 aa AA seqDB search
MKETWRWFGPKDPVSLQHIAQAGATGIVTSLHHIPTGAVWPMEDILERKALIEAHGLEWA
VIESIPLHNDIKTRTGNYREYIANYQQSVRNVAAAGVYDICYNFMPVVDWTRTNLSYTLP
NKSQALRFEMSDFAAYDVYILQRPGAEVDYQPEVLAKAKVRLDAMSEEEKGLLEKNIIAG
LPGGEGSYDRNGIRAAIDQFIRMGDAGMRANLFAFLNEIIPVAEDAGVRMCIHPDDPPFS
LFGLPRVVSTADDARALLNAVPSPSNGLTLCAGSYGARCDNDLVAMAREFGERIYFVHLR
NIKREDDGSFYESDHLDGDNDMVGLIEALLDEEARRDKQGTKLPKISMRPDHGHLMGDEI
GKTGINPGYSFAGRMKGLAELRGVIHAVSVMRARATS
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaaacctggcgctggtttggccctaaagaccccgtctccctgcaacatatcgcc
caagccggcgcaaccggcatagtgacatctctccatcatattccgaccggagcagtctgg
ccgatggaggatatcctggagcgcaaggcgctcattgaagcccatggattagagtgggcg
gtcattgagagcattcctttgcacaacgatataaagacccgtaccggcaactaccgtgaa
tatattgccaattaccagcaatcggttcgcaacgtcgcggcggccggggtttacgacatt
tgctacaacttcatgccagtcgtggactggacccgcaccaacctgagctacaccctgccc
aataaaagccaggcattgcgttttgagatgagcgattttgcggcttacgatgtgtatatc
ctccagcgccccggcgccgaagttgattatcaaccagaggtgctggccaaagccaaggtg
cgcctggatgccatgagcgaggaagaaaaagggctgttggagaaaaacatcatcgccgga
ctgcccggtggcgagggctcctatgaccggaacggtattcgcgcggctattgaccaattt
atccggatgggcgatgcaggcatgcgcgccaacctgttcgcctttttaaacgagatcatc
cccgttgccgaagacgcgggcgtgcggatgtgtattcacccggatgacccacccttttca
ctgttcggcctgccgcgcgtcgtgtctactgccgacgatgcccgcgccctgctcaatgct
gttcccagtccgtccaatggccttaccttgtgtgccggatcttacggtgcgcgctgcgac
aatgacctggtcgccatggcgcgggagtttggtgagcgcatctattttgtgcatctgcgc
aatataaagagggaagatgacggttccttctacgaatcggaccatctggatggcgacaac
gatatggtcggcctgattgaagccctgctggatgaagaagcgcgccgcgacaagcaaggc
acaaaattgccaaagatcagtatgcgcccggaccacggccacctgatgggcgatgagatc
ggtaaaaccggcatcaaccccggttactcgttcgccggcaggatgaaaggacttgcggag
ttgcgcggcgtcatccatgccgtttcggtcatgcgcgcacgcgccaccagttaa

DBGET integrated database retrieval system