KEGG   Cellvibrio sp. PSBB006: CBR65_10895Help
Entry
CBR65_10895       CDS       T04891                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cell  Cellvibrio sp. PSBB006
Pathway
cell00071  Fatty acid degradation
cell00072  Synthesis and degradation of ketone bodies
cell00280  Valine, leucine and isoleucine degradation
cell00310  Lysine degradation
cell00362  Benzoate degradation
cell00380  Tryptophan metabolism
cell00620  Pyruvate metabolism
cell00630  Glyoxylate and dicarboxylate metabolism
cell00640  Propanoate metabolism
cell00650  Butanoate metabolism
cell00900  Terpenoid backbone biosynthesis
cell01100  Metabolic pathways
cell01110  Biosynthesis of secondary metabolites
cell01120  Microbial metabolism in diverse environments
cell01130  Biosynthesis of antibiotics
cell01200  Carbon metabolism
cell01212  Fatty acid metabolism
cell02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cell00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CBR65_10895
   00630 Glyoxylate and dicarboxylate metabolism
    CBR65_10895
   00640 Propanoate metabolism
    CBR65_10895
   00650 Butanoate metabolism
    CBR65_10895
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CBR65_10895
   00072 Synthesis and degradation of ketone bodies
    CBR65_10895
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CBR65_10895
   00310 Lysine degradation
    CBR65_10895
   00380 Tryptophan metabolism
    CBR65_10895
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CBR65_10895
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CBR65_10895
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CBR65_10895
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cell04147]
    CBR65_10895
Enzymes [BR:cell01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CBR65_10895
Exosome [BR:cell04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CBR65_10895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ARU27891
UniProt: A0A1Y0FWP4
Position
2620065..2621387
Genome map
AA seq 440 aa AA seqDB search
MTHSLQDSAAPRATGRPVYLVDGARTPFLKARGKPGPFSPVDLAVQCGRPLLLRLDIPAD
AFDQVILGCVNVVAGEMNPARIAALRLGMGEAMTAFTVQINCGSGMQSVDTAFRYIREGS
ADLILAGGTEALSHAPMVLEDEAVEWLAGVQQAKSLADRLHQLTHFKPGFLKPVISLKRG
LTDPIAELNMGQTAEVIAHLFNITRLQADEYAVSSHHRLARAQQEGWLKQEVLPVFSDAG
ELFEDDDGVRPDSSLESLTKLKPVFEAPYGKVTAGNSSQITDGASWLVLASEEAVQKYQL
TPRAVILDSDWAALDPAIMGLGPVLSCSSLLTRNQLALDDIDLWELNEAFAAQVLACLAA
FNDADFCRTALGRETPWGLIDRNRLNIDGGAVSLGHPVGTSGNRIVLHLMNAMQRNGFKR
GIATECIGGGQSGAMLIEAV
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgacccattcgctgcaagattccgccgcgcctcgcgcaaccggtcgccccgtgtatctg
gtggatggtgcgcgcacgccttttttgaaagcgcgcggcaaacccggtccgttttcgccg
gtggatctggcggtgcagtgcgggcgcccattgctgttgcgtctggatatccccgccgat
gcttttgaccaggtgatcctcggctgcgtcaatgtggtggcgggcgagatgaaccccgcg
cgcattgcggcgctgcgtttgggtatgggtgaagccatgacggcttttaccgtacagatc
aattgcggttccggtatgcagtccgtggatactgcctttcgttatatccgtgaaggctcg
gcagatttgattctcgccggcggtaccgaagccctgagtcacgcgcccatggtgctggag
gacgaggcggtggagtggctggccggcgtgcagcaagccaaaagccttgcggatcgcctg
caccaactcacgcacttcaagccaggcttccttaagccggtcatcagtttgaaacggggc
ctgacagatcccatcgccgagttgaacatggggcaaactgccgaagtaatcgctcactta
tttaatatcacgcgcctgcaggcggacgaatacgccgtatccagccatcaccggctggcc
cgcgcacaacaggaaggctggctcaaacaggaagtcttacccgtcttcagcgatgccggg
gaattgttcgaagacgatgacggcgtgcggcccgacagctcgctggagtccctgaccaaa
ctgaagccggtattcgaagcaccttacggcaaggtcacggccggcaatagctcgcaaatt
accgacggcgcttcctggctggtgctggcctcggaagaggcggtacagaaataccaactc
acccccagggcggtaatcctcgacagcgactgggctgcgctcgacccggcgatcatgggc
ctggggccggtcctcagttgctccagcctgctgacgcgcaaccaactggcgctggatgat
attgacctgtgggaactcaacgaagccttcgcggcacaggtgctcgcctgtctggccgcc
ttcaacgacgccgatttctgccgcaccgcattgggtcgcgaaaccccttgggggctgatt
gatcgcaaccggctgaatatcgacggcggcgccgtcagcctaggccacccggtgggcacc
agcggcaaccggatcgtcctgcatctgatgaatgccatgcagcgcaacgggttcaaacgt
ggcatcgccacagaatgtattggcggcggacaatccggcgctatgttgattgaagcagtc
tag

DBGET integrated database retrieval system