KEGG   Cellvibrio sp. PSBB006: CBR65_15935Help
Entry
CBR65_15935       CDS       T04891                                 

Definition
(GenBank) glycine cleavage system protein T
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
cell  Cellvibrio sp. PSBB006
Pathway
cell00260  Glycine, serine and threonine metabolism
cell00630  Glyoxylate and dicarboxylate metabolism
cell00670  One carbon pool by folate
cell01100  Metabolic pathways
cell01110  Biosynthesis of secondary metabolites
cell01130  Biosynthesis of antibiotics
cell01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cell00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    CBR65_15935
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CBR65_15935
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    CBR65_15935
Enzymes [BR:cell01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     CBR65_15935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T GCV_T_C TrmE_N POPLD
Motif
Other DBs
NCBI-ProteinID: ARU28810
UniProt: A0A1Y0FZG6
Position
3824527..3825615
Genome map
AA seq 362 aa AA seqDB search
MGHKTALFTLHQAMGGKLVDFGGWDMPLHYGSQLEEHHKVRRAAGMFDVSHMTVVDVSGT
DAKAYLQRLLANDVARIENEPGKALYSAMLNEAGGVIDDLIVYNMSGWFRVVVNCSTREK
DLAWMTRIAADFAVELQERDDLAMIAIQGPNAMALTKQVTGEARAALIDQLAVFQGKESG
SWFIARTGYTGEDGVEIMLPNGEAPGFWQALANVGVAPCGLGARDTLRLEAGMNLYGHEM
DEDTSPLLANMGWTIAWEPASRDFIGRPVIEAQKAAGVQQKLVGLVLRERGVLRAEQVVI
VEGTDARGVITSGTFSPTLGYSIALACVPVSIGSHCQVEMRGKLVTVEVVKPNFVRHGQP
LV
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgggacacaagacagcactttttaccctgcaccaggccatgggcggcaagctggtggat
ttcggcggttgggatatgccgctgcactatggctcgcagctggaagagcaccacaaggta
cgccgcgccgccggtatgtttgatgtgtcccacatgaccgtcgtggatgtcagcggtact
gatgccaaagcctacctgcaacgcctgctcgccaatgatgtggcccgtattgaaaacgaa
ccgggcaaagccctctacagcgccatgctcaatgaagcgggcggcgttatcgatgacctg
attgtgtacaacatgagcggctggttccgcgtggtggtcaactgttccacccgggaaaaa
gacctcgcctggatgacccggattgccgccgactttgcggtagagctgcaagagcgcgat
gacctcgccatgatcgccatccagggtccgaatgccatggcgctgaccaagcaggtaact
ggcgaggcccgcgcggcactgattgatcaattggcggtctttcagggcaaagaaagcggc
agctggtttatcgcccgcacgggttacaccggcgaagacggcgtggaaatcatgctgccc
aacggcgaagcccccggtttctggcaagccctggccaacgtgggcgtcgcaccttgcgga
ctcggcgcccgcgataccttacgcctggaagccggcatgaacctgtacggccacgagatg
gacgaagacacttcaccgctgttggccaacatgggttggaccatcgcctgggaaccggcg
agccgggattttatcggccgcccggtgatcgaagcgcaaaaagccgctggcgttcaacag
aaactggtaggactggtcctgcgcgagcgcggcgtattgcgtgctgagcaggtagtgatc
gtcgaaggcaccgacgcgcgcggtgtgattaccagcggcacattttcgccgaccttgggc
tattctattgctttggcctgtgtccccgtcagcatcggcagccactgccaggttgaaatg
cgcggcaagctggtcacggtcgaagtggttaagccaaactttgtacgccacggtcagccg
ctggtgtaa

DBGET integrated database retrieval system