KEGG   Cellvibrio sp. PSBB006: CBR65_19950Help
Entry
CBR65_19950       CDS       T04891                                 

Definition
(GenBank) sugar dehydrogenase
  KO
K00034  glucose 1-dehydrogenase [EC:1.1.1.47]
Organism
cell  Cellvibrio sp. PSBB006
Pathway
cell00030  Pentose phosphate pathway
cell01100  Metabolic pathways
cell01120  Microbial metabolism in diverse environments
cell01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cell00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CBR65_19950
Enzymes [BR:cell01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.47  glucose 1-dehydrogenase [NAD(P)+]
     CBR65_19950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR DUF1776 Epimerase Nitro_FeMo-Co AtuA
Motif
Other DBs
NCBI-ProteinID: ARU29527
UniProt: A0A1Y0G1J2
Position
4806185..4806952
Genome map
AA seq 255 aa AA seqDB search
MRLINKVALVTGSTQGIGLGIAERLAKEGADIIIAGRIEDERSIAAAEQVRAHGRRVCVL
AGDISDVATCRYLIAEGVARMGSIDILINNAGVEKSAPFWEMTEAHFDRTMSVNLKGAFF
TAQAFVQHLRDTERGGKIINISSVHEELPFPNFTAYCASKGALKMMARNLAIELAPLGIT
VNNIAPGAIETPMNKNLLNNPALLEKLLCNIPLRRLGQPEDVAGLAAFLASADADYVTGS
TFYVDGGLLWNYTEQ
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgagactgatcaataaagtggctttggtaaccggcagcacgcagggtataggcttgggt
attgccgagcgcctggcaaaagaaggggccgatatcattattgccgggcgcatcgaagat
gaacgttctattgcggcagctgaacaggttcgggctcacggtcgtcgcgtgtgcgtactg
gctggggatatctccgacgtggcaacctgccggtatttgattgctgagggcgtggcgcgg
atgggatcaattgatattctgatcaataatgccggggtagaaaagtctgcgcctttctgg
gagatgacggaagcgcattttgatcgcaccatgagcgtcaatctaaaaggcgcgttcttc
accgcccaagctttcgtgcaacatctgcgcgatacagagcgtggaggaaaaattattaat
atcagctccgttcacgaagaattacctttcccaaactttactgcctattgcgcgagtaaa
ggtgcactcaagatgatggcgcgcaatctggccattgagttggcgcctctcggcattact
gtcaacaacatcgcaccgggcgccattgaaacgcctatgaataaaaatttactcaacaac
cccgcgctactggaaaagctgctgtgcaatattccgctacggcgcctcgggcagccggaa
gatgtcgctggtttagcggcattcctcgcatcagcggatgcagactatgttaccggttca
accttttatgttgatggaggcctgttgtggaattatacggagcagtaa

DBGET integrated database retrieval system