KEGG   Cellulomonas sp. Z28: E5225_13270Help
Entry
E5225_13270       CDS       T05988                                 

Gene name
mca
Definition
(GenBank) mycothiol conjugate amidase Mca
  KO
K18455  mycothiol S-conjugate amidase [EC:3.5.1.115]
Organism
celz  Cellulomonas sp. Z28
Brite
KEGG Orthology (KO) [BR:celz00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    E5225_13270 (mca)
Enzymes [BR:celz01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.115  mycothiol S-conjugate amidase
     E5225_13270 (mca)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PIG-L
Motif
Other DBs
NCBI-ProteinID: QCB95415
UniProt: A0A4V1CN70
Position
complement(2956322..2957185)
Genome map
AA seq 287 aa AA seqDB search
MAVHAHPDDESSKGAATTARYAAEGVDVLVVTCTGGERGDVLNPHYGPAPAGGEEMAAVR
REEMAAAAAALGVRQHWLGFVDSGLPEGDPLPPLPDGCFALVPLEEASAPLVELVRDFRP
HVVTTYDPSGGYPHPDHVMCHRVAVEAFAAAGDPERYRDRGAPWTPLKLYYNHGFSLARM
RTVHDAIVAAGGESPFSDWIDSRQAREVPERPVTTRVECADYFPQRDAALRSHATQIDPE
GWFFAVPREVELAQWRTEEFELAESRVPTTLPEDDLFAGIRGTEAAR
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atggcggtgcacgcgcaccccgacgacgagtccagcaagggggccgcgacgaccgcgcgc
tacgcggccgagggcgtcgacgtgctcgtcgtcacctgcaccggcggggagcgcggcgac
gtgctgaacccgcactacgggccggcgcccgcgggcggcgaggagatggcggcggtccgg
cgcgaggagatggcggccgccgccgcggcgctcggcgtgcgccagcactggctcggcttc
gtcgactccggcctgcccgagggcgacccgctgccgccgctgcccgacggctgcttcgcg
ctcgtgccgctcgaggaggcgtccgcgccgctcgtcgagctggtccgcgacttccgcccg
cacgtcgtcacgacctacgaccccagcggcgggtacccgcacccggaccacgtcatgtgc
caccgggtcgcggtcgaggcgttcgccgccgcgggcgaccccgagcgctaccgcgaccgc
ggggcgccctggacgccgctgaagctgtactacaaccacggcttctcgctggcccgcatg
cgcaccgtgcacgacgcgatcgtcgcggccggcggcgagtcgccgttcagcgactggatc
gactcgcggcaggcgcgggaggtgcccgagcgcccggtgaccacgcgcgtcgagtgcgcc
gactacttcccgcagcgtgacgcggccctgcgctcccacgcgacgcagatcgaccccgag
ggctggttcttcgccgtcccgcgcgaggtcgagctcgcgcagtggcgcaccgaggagttc
gagctcgcggagtcgcgggtgccgacgacgctgcccgaggacgacctgttcgcggggatc
cgcgggacggaggcggcgcggtga

DBGET integrated database retrieval system