KEGG   Cellulomonas sp. Z28: E5225_13770Help
Entry
E5225_13770       CDS       T05988                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
celz  Cellulomonas sp. Z28
Pathway
celz00450  Selenocompound metabolism
celz00970  Aminoacyl-tRNA biosynthesis
celz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:celz00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    E5225_13770
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    E5225_13770
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:celz01007]
    E5225_13770
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:celz03016]
    E5225_13770
Enzymes [BR:celz01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     E5225_13770
Amino acid related enzymes [BR:celz01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   E5225_13770
Transfer RNA biogenesis [BR:celz03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    E5225_13770
 Prokaryotic type
   Other AARSs
    E5225_13770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1
Motif
Other DBs
NCBI-ProteinID: QCB94463
UniProt: A0A4P7SP57
Position
complement(3078373..3080166)
Genome map
AA seq 597 aa AA seqDB search
MSRILSAVAWPYANGPRHIGHVAGFGVPSDVFSRYMRMAGHDVLMVSGTDEHGTPILVQA
DKEGVGAQELADRYNRVIVEDLTQLGLSYDLFTRTTTRNHYAVVQEMFRTVHKNGYMVAR
TTMGAVSPSTGRTLPDRYIEGTCPICGYDGARGDQCDNCGNQLDPIDLKNPRSRINGETP
KFVESEHFFLDLPALTDALGAWLRTRTQWRPNVLKFSLNLLDDVRPRAMTRDIDWGIPVP
LPGWEDNNAKRLYVWFDAVIGYLSASVEWARRSGDPDAWRQWWNDPSALSYYFMGKDNIT
FHSQIWPAELLAYDGKGARGGEPGAYGSLNLPTEVVSSEFLNVEGKQFSSSRGVVILVRD
MLSRYQPDALRYYISAAGPEAQDVDFTWQEFKRRTNDELVAGWGNLVNRTASMVHKNFGV
IPTPGQRQPVDEALLAEVTTAFGRVGELVGTHRQRAALGEAMRVVGEANRYVSETEPWKL
KGDPDRLATVLHTTTQAVSDLNTLLAPFLPFAAQQVHETFGGTGTFSPQPRIDEVTDLDD
DSRGYPVITGDYRLGATVAPWQPRAVVPGTPVAKPTPVFTKLDDAIVEEELDRLRQG
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgcatcctgtcggccgtcgcgtggccctacgccaacggcccccgtcacatcggt
catgtcgccgggttcggcgtcccctcggacgtgttcagccggtacatgcgcatggcgggc
cacgacgtgctcatggtgtcgggcacggacgagcacgggacgccgatcctcgtgcaggcc
gacaaggagggcgtcggcgcgcaggagctcgcggaccggtacaaccgcgtcatcgtcgag
gacctcacgcagctcggcctgtcctacgacctgttcacgcgcacgacgacgcgcaaccac
tacgcggtcgtgcaggagatgttccgcacggtgcacaagaacgggtacatggtcgcgagg
acgacgatgggcgcggtcagcccgtcgacgggccgcaccctgccggaccgctacatcgag
ggcacgtgcccgatctgcgggtacgacggtgcgcgcggcgaccagtgcgacaactgcggc
aaccagctcgacccgatcgacctgaagaacccgcgcagccgcatcaacggcgagacgccg
aagttcgtcgagtccgagcacttcttcctcgacctgcccgcgctcacggacgcgctcggc
gcgtggctgcgcacgcgcacgcagtggcgtccgaacgtcctgaagttctcgctcaacctg
ctcgacgacgtgcgcccgcgcgccatgacgcgggacatcgactggggcatcccggtgccg
ctgccgggctgggaggacaacaacgccaagcgcctgtacgtgtggttcgacgcggtgatc
gggtacctgtccgcgtcggtcgagtgggcgcggcgcagcggcgacccggacgcgtggcgg
cagtggtggaacgatccgtccgcgctgtcgtactacttcatgggcaaggacaacatcacg
ttccacagccagatctggccggcggagctgctcgcctacgacggcaagggcgcgcgcggc
ggcgagccgggtgcctacgggtcgctcaacctcccgaccgaggtcgtctcgagcgagttc
ctcaacgtcgagggcaagcagttctcgtcctcgcgcggggttgtcatcctcgtgcgcgac
atgctgtcgcggtaccagccggacgcgctgcggtactacatctccgcggcggggcccgag
gcgcaggacgtcgacttcacgtggcaggagttcaagcgccgcacgaacgacgagctcgtc
gccgggtggggcaacctcgtcaaccgcaccgcgagcatggtgcacaagaacttcggcgtg
atcccgacgccggggcagcgccagcccgtggacgaggcgctgctggccgaggtgacgacc
gcgttcggccgtgtcggggagctcgtcggcacgcaccgccagcgcgccgccctgggcgag
gccatgcgcgtggtcggtgaggcgaaccggtacgtctccgagacggagccgtggaagctc
aagggcgacccggaccgcctcgcgaccgtgctgcacacgacgacgcaggcggtgagcgac
ctcaacacgctgctcgcgccgttcctgccgttcgccgcgcagcaggtgcacgagaccttc
ggcggcacggggacgttctcgccgcagccccgcatcgacgaggtcacggacctcgacgac
gactcgcggggctaccccgtcatcacgggcgactaccggctcggtgcgacggtcgcgccg
tggcagccgcgcgcggtcgtgccgggcacgccggtcgcgaagccgacgccggtgttcacg
aagctcgacgacgcgatcgtcgaggaggagctcgaccggctgcgccagggctga

DBGET integrated database retrieval system