KEGG   Cedecea neteri M006: LH23_03820Help
Entry
LH23_03820        CDS       T03328                                 

Definition
(GenBank) phosphoenolpyruvate carboxykinase
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
cem  Cedecea neteri M006
Pathway
cem00010  Glycolysis / Gluconeogenesis
cem00020  Citrate cycle (TCA cycle)
cem00620  Pyruvate metabolism
cem01100  Metabolic pathways
cem01110  Biosynthesis of secondary metabolites
cem01120  Microbial metabolism in diverse environments
cem01130  Biosynthesis of antibiotics
cem01200  Carbon metabolism
Module
cem_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cem00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LH23_03820
   00020 Citrate cycle (TCA cycle)
    LH23_03820
   00620 Pyruvate metabolism
    LH23_03820
Enzymes [BR:cem01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     LH23_03820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP AAA_33
Motif
Other DBs
NCBI-ProteinID: AIR59808
Position
784900..786519
Genome map
AA seq 539 aa AA seqDB search
MRVKGITPQDLKAYGIHDVSEVVYNPDYDTLYREELDPNLQGFERGVVTNLGAVSVDTGI
FTGRSPKDKYIVRDDTTRDTLWWADNGKGKNDNKPLSEETWHQLKGLVTHQLSGKRLFII
DAFCGANADTRLSVRFITEVAWQAHFVKNMFIRPTDEELETFEPDFVVMNGAKCTNPNWK
EQGLNSENFVAFNLTERMQLIGGTWYGGEMKKGMFSIMNYLLPLKGIASMHCSANVGEKG
DVAVFFGLSGTGKTTLSTDPKRRLIGDDEHGWDDDGVFNFEGGCYAKTIRLSEEAEPDIY
HAIRRDALLENVTVRADGTIDFDDASKTENTRVSYPIYHIDNIVKPVSKAGHATKVIFLT
ADAFGVLPPVSRLTANQTQYHFLSGFTAKLAGTERGVTEPTPTFSACFGAAFLSLHPTQY
AEVLVKRMQASGAQAYLVNTGWNGTGKRISIKDTRAIIDAILDGSLDDAETFTLPMFNLA
IPTALAGVDTQILDPRNTYASPEQWQEKAEQLAKLFVENFEKYTDTPAGAALVEAGPKL
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgcgagttaaaggcataaccccgcaagatctcaaggcttatggcattcatgacgtcagc
gaagtcgtctataaccccgattacgacaccctttaccgcgaagaactcgaccctaacctg
cagggttttgagcgcggtgtggtcactaacttaggcgctgtctccgtagataccgggatc
ttcaccggccgctctccaaaagataaatacatcgtccgcgatgacaccacccgcgacacc
ttatggtgggccgacaacggtaaaggcaaaaacgataacaaaccgctttccgaagaaacc
tggcaccagcttaaagggctcgtcactcatcaactgtcgggcaagcgcctgtttattatt
gacgctttctgcggcgccaacgccgatacccgcctgtcagtacgttttatcaccgaggtt
gcctggcaggcccacttcgtgaaaaacatgtttattcgcccaacggacgaagagctggag
acgtttgagcctgattttgtggtgatgaacggagctaaatgtaccaatccaaactggaaa
gaacagggcctgaactccgaaaacttcgtggcgtttaacctgactgaacgcatgcagctt
atcggcggcacctggtacggcggcgagatgaagaaagggatgttctctatcatgaactac
ctgctgccgctgaaaggcatcgcttccatgcactgctcggcaaacgtcggtgaaaaaggc
gatgtggcggtgttcttcgggctgtccggcaccggtaaaacaacgctgtctaccgacccg
aaacgccgcctgattggcgacgatgagcacggctgggacgacgacggcgtgtttaacttt
gaaggcggctgctacgccaaaaccattcgcctgtcggaagaggcagagccggatatctat
cacgcgatccgccgcgatgcgctgctggaaaacgtcaccgtccgtgctgacggcacaatc
gacttcgacgatgcgtccaaaacggaaaacacccgcgtttcttacccgatttatcacatc
gacaacattgttaagccagtgtcgaaagcgggccacgcgaccaaagttatcttcctgact
gcggacgcgttcggcgtattgccgccggtttcccgtctcaccgcgaaccagactcagtac
cacttcctgtccggttttaccgccaaactggcgggcaccgagcgcggcgtgactgagcca
acgccaaccttctccgcctgcttcggcgcagcgttcctgtcgctgcacccaactcagtat
gcggaagtgctggtgaaacgcatgcaggcatccggcgcgcaggcgtacctggtgaatacc
ggctggaacggcaccggcaaacgcatttcgatcaaagacacccgcgcgatcatcgacgct
attctcgacggctcactggacgacgcagaaacctttacgctgccgatgtttaacctcgct
attccaaccgctctcgcaggcgtggacacccagattctggacccacgtaatacctacgcc
tctccggagcagtggcaggaaaaagcagagcagttggcgaagctgtttgtcgaaaacttc
gagaaatacaccgacacccctgccggggcggccctggtcgaagctggtccgaagctgtaa

DBGET integrated database retrieval system