KEGG   Cedecea neteri M006: LH23_05540Help
Entry
LH23_05540        CDS       T03328                                 

Definition
(GenBank) bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase
  KO
K13038  phosphopantothenoylcysteine decarboxylase / phosphopantothenate---cysteine ligase [EC:4.1.1.36 6.3.2.5]
Organism
cem  Cedecea neteri M006
Pathway
cem00770  Pantothenate and CoA biosynthesis
cem01100  Metabolic pathways
Module
cem_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:cem00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    LH23_05540
Enzymes [BR:cem01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     LH23_05540
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.5  phosphopantothenate---cysteine ligase (CTP)
     LH23_05540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DFP Flavoprotein PALP
Motif
Other DBs
NCBI-ProteinID: AIR60141
Position
complement(1166626..1167840)
Genome map
AA seq 404 aa AA seqDB search
MMGLSGKKIVLGVSGGIAAYKTPELVRRLRDRGADVRVVMTEAAKAFITPLSLQAVSGYP
VSDSLLDPAAEAAMGHIELGKWADLVILAPATADLIARVAAGMANDLVSTICLATAAPVA
VVPAMNQQMFRAAATQHNLDVLSARGLLIWGPDSGSQACGDIGPGRMLDPLTLVDMAVEH
FSVVKDLQHLNVMITAGPTRERLDPVRYITNDSSGKMGFAIAAAAAARGANVTLISGPVN
LPTPAWVNRIDITTALEMNEAVQQRVAGQHIFIGCAAVADYRAAVVADEKIKKQGDEITL
KMVKNPDVVAGVAALSEGRPYVVGFAAETNNVEEYARKKRAAKNLDLICANDVSQNNQGF
NSDNNALHLFWQEGDKVLPLERKALLGHLLLDEIVTRYDEKNRR
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgatgggactttccggcaagaaaattgttcttggtgtgagcggtggtattgctgcctat
aaaacacctgagctggttcgtcgtctgcgcgatcgcggagcggatgtacgagtggtaatg
accgaggcggcgaaggccttcatcacgccactaagtttgcaagcagtgtccggttatccg
gtgtccgacagtttgctagaccccgcagcagaagccgccatgggccacatcgaactcggc
aaatgggcagacttagtgatactcgcccctgcgacagcagaccttatcgcgcgcgtggct
gcaggcatggcaaacgacctggtcagcaccatctgcctggcaacagccgccccagttgcc
gttgttccggcaatgaaccaacaaatgttccgcgcggctgccactcaacataatctggat
gtcctaagcgctcgtggtctcctgatttggggcccggatagcgggagccaggcctgcggc
gatattgggcctggtcgcatgctggatccgctaacgctggttgatatggccgttgaacat
ttctccgtagtcaaagatctgcaacatctgaacgtcatgattaccgccggcccaacgcgt
gaacgccttgatcccgtcagatatattacgaacgacagctctggaaaaatggggtttgct
atcgctgcggcagcggcagcgcgcggggcaaacgtaaccctgatttcaggcccggtaaat
ctgcctactccggcgtgggtcaaccgcattgacatcactacggcgctggaaatgaatgag
gcggtccaacaacgcgtcgccgggcagcatatattcattggctgtgccgccgttgccgac
tatcgagcagccgtggttgctgacgagaaaattaaaaagcaaggcgatgaaattacgcta
aaaatggtcaaaaacccggatgttgttgcgggtgttgcggcactttcagaagggcgtccc
tatgttgtagggtttgccgccgaaacaaataatgtggaagaatacgcccggaaaaagcgt
gccgctaaaaacctggatctgatctgcgccaatgacgtatctcagaataatcaagggttt
aatagcgacaataacgcattgcaccttttctggcaggagggagacaaagtcttaccgctt
gagcgtaaagcactccttggccaccttttactggacgagatcgttacccgctatgatgaa
aaaaatcgacgttaa

DBGET integrated database retrieval system