KEGG   Cedecea neteri M006: LH23_08775Help
Entry
LH23_08775        CDS       T03328                                 

Gene name
apaG
Definition
(GenBank) heavy metal transporter
  KO
K06195  ApaG protein
Organism
cem  Cedecea neteri M006
Brite
KEGG Orthology (KO) [BR:cem00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    LH23_08775 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: AIR60747
Position
complement(1841066..1841443)
Genome map
AA seq 125 aa AA seqDB search
MLDSPRVCVQVQSVYIESQSSPDEERFVFAYTVTIRNLGRTAVQLLGRYWLITNGNGRET
EVQGEGVVGEQPHIEPGNDYQYTSGAVIETPLGTMQGHYEMVDAQGEAFRVEIPVFRLAI
PTFIH
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgcttgattcgccccgcgtatgcgtacaggtgcaaagcgtttatattgagtcgcaatcc
tcaccggatgaagaacgtttcgtctttgcgtacacagtcactattcgcaatctggggcga
accgcagttcagctacttggccgttactggctaatcaccaacggtaacggccgagaaacc
gaggttcagggcgaaggtgttgtcggcgaacagccgcacattgagcctggcaacgactac
cagtacacaagcggagcggttatcgaaacgccgctcggcaccatgcagggccattatgaa
atggtcgatgcacagggagaggccttcagggtcgaaatcccggttttccgtctggccatt
ccaactttcattcactga

DBGET integrated database retrieval system