KEGG   Cedecea neteri M006: LH23_10100Help
Entry
LH23_10100        CDS       T03328                                 

Definition
(GenBank) ACP phosphodiesterase
  KO
K08682  acyl carrier protein phosphodiesterase [EC:3.1.4.14]
Organism
cem  Cedecea neteri M006
Pathway
cem00770  Pantothenate and CoA biosynthesis
Brite
KEGG Orthology (KO) [BR:cem00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    LH23_10100
Enzymes [BR:cem01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.14  [acyl-carrier-protein] phosphodiesterase
     LH23_10100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ACP_PD
Motif
Other DBs
NCBI-ProteinID: AIR60999
Position
complement(2133527..2134108)
Genome map
AA seq 193 aa AA seqDB search
MNFLAHLHLAHLAQSSLLGNLLADFVRGSPDDSFSPEVVAGIYMHRRVDVLTDGLPEVAL
ARGWFGPKTRRVSPISLDVMWDHFLSRHWDKVCPDIELEDFVAYARGQIVPKLDDTPPRF
INLNNYLWRERWLERYQDMDFIANVLNGMASRRPKLDALRDSWHDLDAHYDQLEELFWQF
YPRMMAMAEQKSL
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgaattttctcgcccacctgcatctggcacatctggcccaaagttcactgctgggaaat
ttgctggcggatttcgtgcgcggcagcccggacgacagcttttcgcccgaggtcgtggcc
ggaatttatatgcaccgcagagtcgatgtcctgacggacgggctgccggaagtggctctt
gcgcgaggctggtttggccctaaaacgcgtcgcgtgtcgcctatttcgctggacgtgatg
tgggaccacttcctgtcgcgccactgggataaagtctgccccgatatcgagcttgaagat
tttgtcgcctatgctcgcggccagattgtgccaaagcttgacgacacgccgccgcgtttc
attaatctcaataactatttgtggcgcgaacgctggctggagcgttaccaggatatggac
tttattgctaacgttctcaatgggatggcaagccgtagaccaaaactcgatgccctgcga
gattcctggcacgatctcgacgcccattatgaccagttggaggagttgttctggcagttc
tacccgcgcatgatggcgatggcggaacaaaaaagtttgtga

DBGET integrated database retrieval system