KEGG   Cedecea neteri M006: LH23_12590Help
Entry
LH23_12590        CDS       T03328                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
cem  Cedecea neteri M006
Pathway
cem00260  Glycine, serine and threonine metabolism
cem01100  Metabolic pathways
cem01110  Biosynthesis of secondary metabolites
cem01120  Microbial metabolism in diverse environments
cem01130  Biosynthesis of antibiotics
cem01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cem00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LH23_12590
Enzymes [BR:cem01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     LH23_12590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 Aminotran_5 Cys_Met_Meta_PP DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: AIR61464
Position
complement(2638080..2639081)
Genome map
AA seq 333 aa AA seqDB search
MIDLRSDTVTRPSRAMLEQMMAAPTGDDVYGDDPTVNELQAYAAKISGKEAALFLPTGTQ
ANLVALLSHCERGEEYIVGQAAHNYLYEAGGAAVLGSIQPQPIEADRDGTLPLDKVAAKI
KPDDIHFARTKLLSLENTHNGKVLPREYLQQAWEFTRKHNLALHVDGARIFNAVVSYGCQ
LEEITRYCDSFTICLSKGLGTPVGSLLVGSKEYIKRAVRWRKMTGGGMRQAGILAAAGLY
ALKNNVERLKEDHDNAHWLAGELREIGVDVMRQDTNMVFVRMTAEEAEDLGPYMRERGII
LSAGPATRLVTHLDVTRTQLAEVVAHWRSFLQN
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatttacgcagcgataccgttacccgcccttcccgcgccatgctggaacaaatg
atggccgccccaaccggggatgatgtttacggcgatgaccccactgttaacgagcttcag
gcatacgcggcaaaaatcagcgggaaagaagctgccctgtttttacctaccggcacgcag
gccaacctcgtggctttgctgagccactgcgaacgcggcgaagagtatatcgttggccag
gccgcgcataactacctgtatgaggcgggcggcgcagcggtgctgggcagcattcagcct
cagccgattgaagcggatcgcgacggcacgctgccgctggataaagtggcggcaaaaatt
aaaccggacgacattcacttcgcccgcactaaattgctgagccttgaaaacacccataac
ggcaaagtgctgccacgcgaatacctccagcaggcctgggaattcacccgcaaacacaac
ctggcgctgcacgtagacggcgcgcgtatttttaacgccgtggtgtcctacggctgccag
ctggaagagattactcgctactgcgacagcttcaccatttgcctgtcgaaaggcctgggc
acgccggtgggatccctgctggtgggcagtaaagagtacatcaagcgagctgtgcgctgg
cgcaagatgaccggcggcggtatgcgccaggccggtatcctcgcggcggcaggcctgtat
gcgctgaaaaataacgtcgagcggctgaaagaagaccacgacaacgcccactggctggca
ggcgagctacgagaaatcggcgtcgatgtgatgcgtcaggacaccaacatggtctttgtc
cgcatgacggcggaagaagcagaagatttagggccatatatgcgtgagcgcggcatcatc
ctcagcgcaggcccggcaactcgcctggtcacccatctggacgtcacccgcactcagctg
gcagaagtcgtcgcccactggcgcagcttcctgcaaaactaa

DBGET integrated database retrieval system