KEGG   Cedecea neteri M006: LH23_16895Help
Entry
LH23_16895        CDS       T03328                                 

Definition
(GenBank) histidine kinase
  KO
K07644  two-component system, OmpR family, heavy metal sensor histidine kinase CusS [EC:2.7.13.3]
Organism
cem  Cedecea neteri M006
Pathway
cem02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cem00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LH23_16895
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cem01001]
    LH23_16895
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:cem02022]
    LH23_16895
   01504 Antimicrobial resistance genes [BR:cem01504]
    LH23_16895
Enzymes [BR:cem01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     LH23_16895
Protein kinases [BR:cem01001]
 Histidine kinases
  OmpR family
   LH23_16895
Two-component system [BR:cem02022]
 OmpR family
  CusS-CusR (copper tolerance)
   LH23_16895
Antimicrobial resistance genes [BR:cem01504]
 Gene sets
  beta-Lactam resistance modules
   Imipenem resistance, repression of porin OprD [MD:M00745]
    LH23_16895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HisKA HAMP HATPase_c_5 HATPase_c_2 HATPase_c_3
Motif
Other DBs
NCBI-ProteinID: AIR62269
Position
3547536..3548939
Genome map
AA seq 467 aa AA seqDB search
MIKLSHLSITARLTLYFSVTMAIVLYSVSGVLYSTMRQQLNHKDELELQSSIQFQQEIAT
AIGERQDNGEEWQTELLESVVRQERLSLRIFSPEGKVYAQSNNMVIPEQDFPLPGPGFSY
REWHYRAENIRQKYLITSTLFTLKNNQKWLVQAALNVSGNNEIINTYYKRMQFFAALAIL
LFAAFGWWLARRGLSPLRTITTEIEKIHANDLHTRILDQRWPPELNALAASFDRMMMRLE
ASFHQLNRFSSDIAHELRGPINNLISAASVIQTKDRSAEEYQETLAAIVEEGERLSRMIS
SMLFLARADNSREVLNAEWLSSAHEFEKLIGFYDILAEEKEITLASRGDISFYADPQLIQ
RALSNLLSNALRHTPEKGHITLSAKIADERVILSVSDDGEGIKPEHLPLIFDRFFRGEAS
RSATENTGLGLAIVKTIAELHGGKISVVSEPGRGSTFTLSLPLHDKA
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgataaaactgtcgcatttgtcgatcacggcgcgcctgacgctctacttctccgtcacg
atggccatcgtgctttacagcgtgtccggcgtgctttattcgactatgcgccagcagctc
aatcataaagatgagctggagctacaaagctccattcagttccagcaggaaattgctacg
gcgattggagagcggcaggacaacggggaagagtggcaaaccgagctgctggagtccgtg
gtgcggcaggagcgtctgtcgctgcgcatcttcagcccggaaggcaaggtgtacgcgcaa
tccaataatatggttatcccggagcaggattttccgctgccgggccccgggtttagctac
cgggaatggcattatcgcgcggagaatatccggcaaaaatacttaattacctccacgctg
ttcaccctaaaaaataaccagaaatggctggtacaagcggcgctcaacgtctccggcaac
aacgaaataatcaatacctattataagcgcatgcagttcttcgccgcgctggcgatcctg
ctgtttgccgcctttggctggtggcttgcccgccgggggctatcgccgctgcgcacgatc
accaccgaaattgagaaaattcacgccaacgatctgcacacccggatcctggatcagcgt
tggccgccggaactgaacgcgctggcggcgtcgtttgaccgcatgatgatgcgccttgag
gcctcgtttcatcagctaaatcgcttttcatcggacattgcccacgagctgcgcgggccg
ataaacaacctgatctctgccgccagcgtcattcaaaccaaagaccgcagcgccgaagag
taccaggaaacgctggccgctattgtggaagaaggcgagcggctgtcgcgcatgatctcc
tccatgctgttccttgcccgggcagataacagccgcgaagtgctgaatgccgaatggcta
agcagcgcccatgaattcgaaaaacttattggtttctatgacattctggcagaagaaaaa
gagattaccctcgcaagccggggggacatttcattctatgctgacccgcagcttatccag
cgggcactctcaaatttgctctctaatgccctgcgccacacgcctgaaaaagggcatatc
acgctcagtgcaaaaattgccgatgaacgggtgatattgagcgtgagtgatgatggagaa
ggcatcaaacccgaacatctgccgctgatttttgatcgctttttccggggagaagcctcc
cgcagcgccacggaaaacaccgggctggggctggcgattgtgaaaaccattgcggaactg
cacggcggcaaaatcagcgtggtcagcgagccggggcgcggcagcacgtttacgctctca
ttgccgctgcacgacaaggcctga

DBGET integrated database retrieval system