KEGG   Cedecea neteri M006: LH23_19135Help
Entry
LH23_19135        CDS       T03328                                 

Gene name
rrmA
Definition
(GenBank) 23S rRNA methyltransferase
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
cem  Cedecea neteri M006
Brite
KEGG Orthology (KO) [BR:cem00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:cem03009]
    LH23_19135 (rrmA)
Enzymes [BR:cem01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     LH23_19135 (rrmA)
Ribosome biogenesis [BR:cem03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    LH23_19135 (rrmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_31 Methyltransf_11 Methyltransf_25 Ubie_methyltran Methyltransf_23 Methyltransf_12 PCMT Methyltransf_32 MTS Methyltransf_9
Motif
Other DBs
NCBI-ProteinID: AIR62697
Position
complement(4043347..4044150)
Genome map
AA seq 267 aa AA seqDB search
MSWLCPFCHSVLSASANSYRCPQGHQFDIAKEGYVNLLPVQHKRSKDPGDSAEMMQARRA
FLDAGHYQPLRDALCLLLKEIAPSALLDIGCGEGYYTAGFAAVVAEQGGETWGLDVSKVA
IRYAAKRYREVKFCVASSHRLPFADESMDSIVRIFAPCKAEELSRVVKRGGVVVTATPGP
RHLMQLKGLIYQDIVLHSEEVEAMPGFTLQRTLQPGWMMNLRGDEAVALLQMTPFAWRAR
PEVWEELRGETAFSCETDFVVRVWQRD
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgtcctggctttgcccattctgccattccgtgcttagcgccagcgcgaacagctaccgc
tgccctcaggggcatcaatttgatatagccaaagaaggctatgttaatttgctgcccgtt
cagcataaacgttcgaaagacccgggtgacagcgcggaaatgatgcaggctcgccgggca
ttcctcgacgccggacattatcagccactacgcgatgctctttgcctgctgttaaaagag
atagcgccctctgcactactggatattggctgtggggaagggtattacacggcgggattt
gcagcggtcgtggctgagcagggcggtgagacatgggggctggacgtttcaaaagttgcc
attcgctacgcggctaaacgctaccgggaagtgaaattttgcgttgcatccagccaccgc
ctgccgtttgccgatgagagcatggactcgattgtgcgcatttttgccccctgtaaggct
gaagagctttcgcgagttgtgaagcgcggcggtgtggtggtgacagccacgcctggccca
cgccatttgatgcagctaaaagggctcatttatcaggatattgttttgcacagtgaagag
gttgaagctatgccgggctttacgctgcaacggacactacagccaggctggatgatgaac
ctgcgcggggatgaggctgttgccctgctgcaaatgacgccgttcgcctggcgtgctcgc
cctgaagtttgggaggagctgagaggagaaacggcgtttagctgtgaaactgactttgtg
gtgcgagtctggcagcgcgattga

DBGET integrated database retrieval system