KEGG   Cedecea neteri M006: LH23_21665Help
Entry
LH23_21665        CDS       T03328                                 

Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
cem  Cedecea neteri M006
Pathway
cem00430  Taurine and hypotaurine metabolism
cem00620  Pyruvate metabolism
cem00640  Propanoate metabolism
cem00680  Methane metabolism
cem01100  Metabolic pathways
cem01120  Microbial metabolism in diverse environments
cem01200  Carbon metabolism
Module
cem_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:cem00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LH23_21665
   00640 Propanoate metabolism
    LH23_21665
  09102 Energy metabolism
   00680 Methane metabolism
    LH23_21665
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    LH23_21665
Enzymes [BR:cem01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     LH23_21665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase BcrAD_BadFG
Motif
Other DBs
NCBI-ProteinID: AIR63171
UniProt: A0A291DVN1
Position
4584714..4585916
Genome map
AA seq 400 aa AA seqDB search
MSSKLVLVLNCGSSSLKFAIIDAVNGEEYLSGLAECFHLPEARIKWKLDGAKQEAALGAG
AAHSEALNFIVNKILAEKPELSAQLTAIGHRIVHGGEKYTSSVVIDDSVIQGIKDSASFA
PLHNPAHLIGIAEALKSFPNLADKNVAVFDTAFHQTMPEESFLYALPYKLYKEHGVRRYG
AHGTSHFYVTQEAAKMLNKPVDELNIITCHLGNGGSVSAIRNGKCVDTSMGLTPLEGLVM
GTRSGDIDPAIIFHLHDALGMSVEDINKMLTKESGLLGLTEVTSDCRYVEDNYATKEDAK
RAMDVYCHRLAKYIGSYTALMDGRLDAVVFTGGIGENAAMVRELSLGKLGVLGFDVDHER
NLAARFGKSGFINKEGTRPAVVITTNEELVIAQDASRLTA
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagtaagctagtactggttctgaactgcggtagctcatcactgaaattcgcaatt
atcgatgctgtaaacggtgaagagtacctttctggtttagcagagtgtttccaccttcct
gaagcccgtatcaagtggaagctggacggcgctaaacaagaagcggctctgggtgcaggt
gccgctcacagcgaagctcttaacttcatcgttaataaaattctggcagaaaaaccagaa
ttgtccgctcagctgaccgcaattggtcaccgtatcgtacacggcggtgaaaaatacacc
agctccgttgttatcgatgattctgtgattcagggtatcaaagattcagcctcttttgca
ccgctgcataacccggctcacctgatcggtatcgctgaagccctgaaatccttccctaac
ctggctgataaaaacgttgccgtgttcgacaccgcgttccatcagaccatgccggaagaa
tctttcctctacgctctgccgtacaaactgtacaaagagcacggcgttcgtcgctacggc
gcacacggcaccagccacttctacgtgactcaagaagccgcaaaaatgctgaacaagccg
gttgatgaactgaatatcatcacctgccacctgggcaacggcggttccgtttctgctatc
cgtaacggcaaatgcgttgatacctccatgggtctgaccccgctggaaggtctggtgatg
ggtacccgttccggtgacatcgacccggctatcatcttccacctgcacgatgccctgggc
atgagcgtagaagacatcaacaaaatgctgaccaaagagtccggcctgctgggtctgacc
gaagtgaccagcgactgccgttacgttgaagacaactacgcaactaaagaagacgctaaa
cgtgcaatggacgtttactgccaccgtctggcgaaatacatcggttcttacaccgcgctg
atggatggtcgtctggacgccgttgtcttcaccggcggtatcggtgaaaacgccgcgatg
gtgcgcgagctgtctctgggcaaactgggcgtactgggcttcgatgttgatcacgagcgc
aacctggctgcacgtttcggcaagtctggcttcatcaacaaggaaggcacccgccctgcg
gtggttatcaccaccaacgaagagctggtcatcgctcaggatgcatcccgcctgaccgcc
tga

DBGET integrated database retrieval system