KEGG   Cedecea neteri ND14a: LH86_08835Help
Entry
LH86_08835        CDS       T03337                                 

Gene name
apaG
Definition
(GenBank) heavy metal transporter
  KO
K06195  ApaG protein
Organism
cen  Cedecea neteri ND14a
Brite
KEGG Orthology (KO) [BR:cen00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    LH86_08835 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: AIR65185
Position
complement(1840587..1840964)
Genome map
AA seq 125 aa AA seqDB search
MLDSPRVCVQVQSFYIESQSSPEDERFVFAYTVTIRNLGRTAVQLLGRYWLITNGNGRET
EVQGEGVVGEQPHIEPGNDYQYTSGAVIETPLGTMQGHYEMVDAQGEAFRVEIPVFRLAI
PTFIH
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgcttgattcgccccgcgtatgcgtgcaggtacaaagcttttatattgagtcgcagtcc
tcgcctgaggatgagcgtttcgtatttgcgtacacagtcactattcgcaatctggggcga
acagcagttcagctacttggccgttactggctaattaccaacggtaacggccgcgaaaca
gaggttcagggcgaaggtgtcgtcggcgaacagccgcacattgaaccgggtaacgactac
cagtacaccagcggagcggtgatcgaaacgccgctcggcaccatgcagggccattatgaa
atggtcgatgcgcagggagaggccttcagggtcgagatccccgtattccgtctggccatt
ccaactttcattcactga

DBGET integrated database retrieval system