KEGG   Cedecea neteri ND14a: LH86_09345Help
Entry
LH86_09345        CDS       T03337                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
cen  Cedecea neteri ND14a
Pathway
cen00900  Terpenoid backbone biosynthesis
cen01100  Metabolic pathways
cen01110  Biosynthesis of secondary metabolites
cen01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cen00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LH86_09345
Enzymes [BR:cen01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     LH86_09345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C Semialdhyde_dh
Motif
Other DBs
NCBI-ProteinID: AIR65286
Position
1961881..1963080
Genome map
AA seq 399 aa AA seqDB search
MKQLTILGSTGSIGASTLSVVRHNPEKFSVTALVAGSNVGKMVEQCQEFSPKYAVMASES
AAAEVRRALKEQGSKTEVMAGEQAACEVATLGEVDQVMAAIVGVAGLSSTLAAISAGKQV
LLANKESLITCGRLFMEAVARSKAQLLPIDSEHNAIFQSMPETIQRNLGYASLEDNGVSS
IILTGSGGPFRETAYADLAAMTPDQACSHPNWSMGRKISVDSATMMNKGLEYIEARWLFN
ASAAQMEVLIHPQSVIHSMVRYRDGSVLAQLGAPDMRTPIAHAMAYPARVESGVTPLDFC
KIGSLTFMEPDFERYPCLKLAIDASAQGQAATTALNAANEVVVEAFLNQQVRFTDIAVLN
RSVLEQMNLAEPQSVDEVLSVDAIAREIARKQVMHLASR
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgaagcagctcactattcttggttctaccggctccattggcgccagcacgctaagcgtc
gttcgacataatcctgaaaaattttccgttacggctctggttgcgggcagcaatgtcggg
aaaatggttgagcaatgccaggagttctcgccgaagtatgcggtcatggccagcgagtct
gcggcggcggaagtgcgtcgtgccctgaaagagcaggggagtaaaactgaagtcatggcc
ggtgagcaggccgcttgcgaagttgctacgcttggcgaagtggatcaggtgatggctgct
attgtgggcgtggcagggctgtcgtcaacgcttgctgctatatctgccggtaaacaggtt
ctgctggcgaacaaagagtcgctgataacctgcggccgtttgtttatggaagctgttgcg
cgtagcaaagcgcaattgttgcctatcgacagcgagcataacgccatttttcagagtatg
ccggaaacaatccagcgtaacctgggatacgctagcctcgaagataatggcgtgtcgtct
attatccttactggatcgggtggcccgttccgggaaacggcttatgcagacctggcggcg
atgacgccggatcaggcttgtagccacccgaactggtcgatggggcgtaaaatttccgtc
gactctgccactatgatgaacaaaggtctcgaatacattgaagctcgttggctgttcaac
gcttcagctgcgcaaatggaagtgctgattcaccctcagtctgttattcattctatggtt
cgttaccgcgatggcagtgtgctagcacagcttggggcgcctgacatgcgtacgcctatt
gctcatgcgatggcttaccctgcgcgcgtagaatctggtgttacgccgctcgatttctgc
aaaatcggttcgcttaccttcatggaacctgattttgagcgctatccatgtcttaaatta
gccatcgatgccagcgcgcaagggcaggcggcgacaaccgcgctgaatgccgcgaacgaa
gtggttgtagaggcgttcctgaatcagcaggtcagatttaccgatatcgcggtgctgaac
cgcagcgtgctggagcaaatgaacttagctgaaccacaaagtgtggatgaagtgcttagt
gtggatgctattgctcgtgaaatcgccaggaaacaagtgatgcacctcgcaagccggtga

DBGET integrated database retrieval system